Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51K1 Olfactory Receptor

Gene Symbol OR51K1
Organism Dog
Family 51
Subfamily K
Pseudo No
Location chr21:28,378,500-28,379,500 (-)
Aliases cOR51K1

Sequence information


Nucleotide sequence

ATGGGAGCTGAAAGCAATGAAAGTCTTGACGTCCTATCTGTCTTCCTAACTGGCATCCCA
GGATTAGAGTCCCAGCATGGCTGGCTTTCCATTCCCTTCTCCACTATGTATGTTGTGGCC
ATTGTGGGTAACAGCCTAATCATGATAGCAGTGCAGGAGGACCCTGTGCTACATGAGCCC
ATGTACCTGTTTCTCTCCATGCTGGCTGTGACTGAGGTGGGTGTTTCTGTGTCTACACTG
CCCACTGTCATGGGTATTCTTTGGTTTGATGCCCGCCAGATCGATTTTGATGGCTGCCTG
GCTCAGATGTTCTTCATCCACACCTTCTCTTGTATGGAGTCAGGGGTCCTTTTGGCCATG
AGTTATGACCGCTTTGTAGCCATCTATAATCCACTGCGATATACTGCCATCCTAACCCTG
CCCCGTATCATCTGCATGGGTCTGGGAATCACACTGAAGAGTGTGACACTTATGGCCCCA
CTTCCCATCCTTTTGAAGCAACTGCCTTATTGCCACACTAATGTCCTCTCCCATTCCTAC
TGTCTCCACTCAGACTTGATCCAGCTGCCTTGTGCTGATACTAAGCTCAATAGTATTCTA
GGCTTGGCCATTGTCCTGGCCACTTTTGGGCTGGACTCACTGCTCATTGTGGTCTCTTAT
GTGCTGATTCTTTACACTGTGCTGGGCATTGCTTCTGAGGAGGGACGGTGGAAGGCCCTC
AACACGTGTGTATCACATATGTGTGCAGTGCTTGTGTACTACGTGCCTATGATTGGTGTG
TCTGTGATGCATCGTGCTGCCAAGCATGCCTCACCCCTGGTCCATACACTCATGTCTAGC
ATATACCTTTTTGTGCCCCCTGTGCTCAATCCCATCATCTACAGTGTCAAGACCAAGCCA
ATCCGACAGGGAATTTTCACCTTGTTTTCTTGCAAGAGGAAA


Conceptual translation

MGAESNESLDVLSVFLTGIPGLESQHGWLSIPFSTMYVVAIVGNSLIMIAVQEDPVLHEP
MYLFLSMLAVTEVGVSVSTLPTVMGILWFDARQIDFDGCLAQMFFIHTFSCMESGVLLAM
SYDRFVAIYNPLRYTAILTLPRIICMGLGITLKSVTLMAPLPILLKQLPYCHTNVLSHSY
CLHSDLIQLPCADTKLNSILGLAIVLATFGLDSLLIVVSYVLILYTVLGIASEEGRWKAL
NTCVSHMCAVLVYYVPMIGVSVMHRAAKHASPLVHTLMSSIYLFVPPVLNPIIYSVKTKP
IRQGIFTLFSCKRK