Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51K2 Olfactory Receptor

Gene Symbol OR51K2
Organism Dog
Family 51
Subfamily K
Pseudo No
Location chr21:28,334,700-28,335,600 (+)
Aliases cOR51K2

Sequence information


Nucleotide sequence

ATGTTCAACAGCAGTCAATTCAATCCCAAGTATTTTCTGCTAACTGGTCTCCCTGGTCTG
GAGGCCCTGTACCCTTGGTTTATTGTCCCATTCTGCTCCATATATCTTGTGGCCCTTGTG
GGCAATAGCCTGGTCCTGGCAGTGATCAGGAAAAACACCACTCTGCACCAGCCGATGTAC
CTTTTTCTAGCTATGCTGGCCTTTGCAGAACTTGGTGTCTCTGCTTCTACACTGCCCACT
GTGTTGGGCATCTTCCTTTTTGGTGCCAATGAGATCTGCTTTGAAGCCTGCCTTTTGCAG
ATGTTCTCCATACATTGCTTTTCCATCATGGAGTCAGGAGTTCTGCTGGCCATGTCTGTG
GACCGTTTTGTGGCCATCTACAACCCACTGAGGTACACAGCCATCCTGACCAGGCCCCGT
ATTGCTGCTACTGGTGCTGCACTTGGACTGAAGAGTGTGATGCTCATGTTCCCACTGCCT
TTTCTCCTGAAGCGTCTGCCCTTCTGTGGCCACAATGTCCTCTCCCACTCCTACTGCCTT
CACTCAGATCTAATCCAGCTGCCCTGTGGGGATACACGTCCCAACAGCATTCTGGGGCTC
TGCATTGTTACTTCTACTTTTGGGCTGGATTCGCTGCTCATCATCCTCTCGTATGTGCTG
ATCCTCTACACAGTGCTGGGCATTACCTCTGGGGAGGGAAGGTGTAAGGCCCTCAACACA
TGTGTGTCACATATGTGTGCAGTGCTTGTGTACTATGTGCCCATGATCAGCGTGGCTCTG
GTGCACCGCTTCATGAAGCACACTGCACCTGCTCTCCGTCTACTCCTGGCCAACATCTAT
CTTCTGGTGCCTCCTGTGCTCAACCCCATCATCTACAGTGTTAAGACAAAACAGATTCGC
CAGGGGCTCATCCAACTCTTTCTTCCAAGAAAA


Conceptual translation

MFNSSQFNPKYFLLTGLPGLEALYPWFIVPFCSIYLVALVGNSLVLAVIRKNTTLHQPMY
LFLAMLAFAELGVSASTLPTVLGIFLFGANEICFEACLLQMFSIHCFSIMESGVLLAMSV
DRFVAIYNPLRYTAILTRPRIAATGAALGLKSVMLMFPLPFLLKRLPFCGHNVLSHSYCL
HSDLIQLPCGDTRPNSILGLCIVTSTFGLDSLLIILSYVLILYTVLGITSGEGRCKALNT
CVSHMCAVLVYYVPMISVALVHRFMKHTAPALRLLLANIYLLVPPVLNPIIYSVKTKQIR
QGLIQLFLPRK