Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51Q1F Olfactory Receptor

Gene Symbol OR51Q1F
Organism Dog
Family 51
Subfamily Q
Pseudo No
Location chr21:28,362,200-28,363,100 (+)
Aliases cOR51Q3

Sequence information


Nucleotide sequence

ATGCCTGAGGTCACTAATACCACGCAAGCTCCCTTCTACTTCATCCTCACGGGCATCCCT
GGATTTGAGGCTTTCCACATCTGGATCTCCATCCCCTTCTGCTGCCTCTATACCATCTCC
ATCGTGGGGAACACCACCATTCTCGCTGTCATCCGCACAGAGCCATCCCTCCACCAGCCC
ATGTACCTGTTTCTCTCCATGCTGGCCCTGACTGACCTGGGCCTCACCCTCACTACCTTG
CCCACAGTCATGCAGCTTCTCTGGTTCAACATTCCCAAGATCAGCTTTGAAGCTTGCTTT
GCCCAATTCTTCTTCCTCCATGGATTCTCCTTCATGGAATCTTCAGTCCTATTGGCCATG
TCCTTTGATCGCTATGTAGCCATCTGTTGCCCCCTCCATTATGCCACCATCCTCACCAGT
GAAGTCATTGGCAGGATTGGGTTGGCCATCATTGGCCGCTGTATCCTGGCTGTTCTCCCT
TCCCTTTTCCTACTCAAGCGCCTGCCTTTCTGCCACTCCCATCTTCTCTCTCACTCCTAT
TGCCTCCACCAGGATATGATCCGCCTGGTCTGTGCTGACATCCGGGTCAACAGCTGGTAT
GGATTTGCTCTAGTTTTGCTCATTATTGTCATGGACCCTCTGCTCATCATTCTCTCCTAC
ACGTTCATTCTGAAAAATATCTTGGGCACAGCCTCCTGGACTGAGCGGCTCCGGGCTCTC
AATAACTGTCTATCCCACATTCTGGCTGTTCTGGTGCTTTATGTCCCCATGATTGGAGTA
TCCATGACCCATCGATTTGCCAAGCATGCCTCTCCACTGGTCCATGTTATCATGGCCAAT
GTCTACCTGTTGGCACCTCCTGTGATGAACCCCATCATTTACAGTGTCAAGACTAAGCAA
ATCCGCCAGGGAATCTTCCATGTACTTTTCCAAAGGAAAGTGTAC


Conceptual translation

MPEVTNTTQAPFYFILTGIPGFEAFHIWISIPFCCLYTISIVGNTTILAVIRTEPSLHQP
MYLFLSMLALTDLGLTLTTLPTVMQLLWFNIPKISFEACFAQFFFLHGFSFMESSVLLAM
SFDRYVAICCPLHYATILTSEVIGRIGLAIIGRCILAVLPSLFLLKRLPFCHSHLLSHSY
CLHQDMIRLVCADIRVNSWYGFALVLLIIVMDPLLIILSYTFILKNILGTASWTERLRAL
NNCLSHILAVLVLYVPMIGVSMTHRFAKHASPLVHVIMANVYLLAPPVMNPIIYSVKTKQ
IRQGIFHVLFQRKVY