Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51Q2P Olfactory Receptor

Gene Symbol OR51Q2P
Organism Dog
Family 51
Subfamily Q
Pseudo Yes
Location chr21:28,295,400-28,296,200 (-)
Aliases cOR51Q2P

Sequence information


Nucleotide sequence

GTTACTAACTCCACTCAAGTCCCCTTTTGCTTCATCCTTAATGGCATCCCTGGCTTTGAG
GTTTTCCATAACTGGATTTCCATCCCCTTTTGTTGTCTCTACACTGTCTCCATCATGGGC
AATACCACCATCCTGGCGGTCATCAGGACAGAGCCCTCCCTACATAAGCCCATGTACTTG
TTCCTCTCTATGTTGGCTGTAACAGCTCTGGGGCTCACCCTCACCACTTTGCCTACAGTC
ATGGGAGTCCTCTGGTTTGGGGCCTCAGAAATTAGCTTTGAGGCTTGTTTTGCCCAGTTC
TTCTTCCTCCATGGATTCTCCTTTATAGAATCTTCTGTGTTGCTGGCCATGTCCTTTGAT
CGCTATGTGGCCTTCTGCCGTCCCCTGCATTATGTCTCCATCCTCACCAACCAAGTAATC
AGAAGAATAGGGGTGGCCATCATTTGCCACTGTGTTCTGGCTGTTCCTCCCCCATTGCTC
CTGCTGAAACGATTGCCCTTTTGTGGCTCCCACCAGCTTTCCCACTCCTACTGCCTCCAT
CAAGACATGATTTGCCGGGTGTGTGCTGACACCACTGTCAATAACTGGTATGGATTTGTT
CTAGCTCTGGTCATTATTACACTGGACCCCCTGCTCATTGTGCTTTCCTATGTACTCATC
CTGAGAAGTGTCTTGAGAATCAGCTCCCAGGTTGAAAGGCTTCGGGCACTCAATAACTGT
CTATCCCATATTCTGGCTGTTTTGGTCCTCTATGTGCCCATGGTGGGATTGTCCATGACT
CACCGCTTTGCCAAGCATACCCCTCCAATTGTCATGTCATCATGGCCAGCATCTATCTAT
TAGCGCCTCCCGTGATGAACCCCATTATCTATAGTGTTAAAACAAAACAGATCCGT


Conceptual translation

VTNSTQVPFCFILNGIPGFEVFHNWISIPFCCLYTVSIMGNTTILAVIRTEPSLHKPMYL
FLSMLAVTALGLTLTTLPTVMGVLWFGASEISFEACFAQFFFLHGFSFIESSVLLAMSFD
RYVAFCRPLHYVSILTNQVIRRIGVAIICHCVLAVPPPLLLLKRLPFCGSHQLSHSYCLH
QDMICRVCADTTVNNWYGFVLALVIITLDPLLIVLSYVLILRSVLRISSQVERLRALNNC
LSHILAVLVLYVPMVGLSMTHRFAKH/PSNCHVIMASIYLLAPPVMNPIIYSVKTKQIR