Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51R1 Olfactory Receptor

Gene Symbol OR51R1
Organism Dog
Family 51
Subfamily R
Pseudo No
Location chr21:26,796,500-26,797,600 (+)
Aliases cOR51R2

Sequence information


Nucleotide sequence

ATGGATTGCCTATTCTCTTACATGCAGAGTGGACAACTCCCTCCTGGAATCACTATGTTC
TCCTGCAACACCAGCACTTCTGGTCACTCTACGTTTCTCCTCACTGGCTTTCCAGGCCTG
GAAGCCTCTCATCATTGGGTTTCCATCCCTGTCAACCTCACCTGTGTGGTTTCCATCCTG
GGTAACAGTATCATCCTTCTCCTGATTCGTACAGATCCAGCCTTACATGAACCCATGTAT
TTTTTCCTATCTATGTTGGCAGCCTCTGATCTGGGACTCAGTGCCTCTACCTTTCCCACG
ATGATGTGGCTCTTCTGGCTGAATGCTCGTGAGCTTCCCTTTGATATCTGTGCAGCACAA
ATGTTCTTCATCCATGCCTTCACCTATGTGGAATCTGGTGTGCTACTGGCCATGGCCTTT
GATCGTTTTGTTGCCATCCGGGAACCTCTGCACTATGCCACAATTCTGACTCACTCAGCT
ATGGCCAGAATGGGGGCTGCCATCCTTGTGAGGGCTGTCTTGCTCAATCTCCCAGGACCC
ATCCTCCTGCGACGTCTGCTTTTTCCCCAGATCAGCGTACTCTCTCACTGCTACTGCCTG
CACTGTGACCTTGTGGGACTGGCCTGCTCAGACACCCAGATAAACAGCTTGGTTGGCCTA
GTCTCCATTCTCTTCTCACTAGGCCTTGACTCCTTCCTCATTGTGCTCTCATATGCCCTG
ATCCTACGAACAGTGGTGAGCATTGCATCACCTGGGGAAAGGCTCAAGGCACTTAACACG
TGTGTCTCACATCTCTGCATTGTTCTCATCTTTTATTTGCCCAAACTAGGGCTATCTGTG
TTGCACCGGGTAGAGAAGCACAACTACCCTGCTCTGGCAGTGCTCATGGCCAACCTGCAC
TTCTTGGTCCCACCTTTCATGAACCCTATTGTTTACTGCATCAAGTCTAAACAGATACGT
CAGGGCCTCCTAAAGCGCTTCAAACGGAAGAGGGTTGACGTCTCC


Conceptual translation

MDCLFSYMQSGQLPPGITMFSCNTSTSGHSTFLLTGFPGLEASHHWVSIPVNLTCVVSIL
GNSIILLLIRTDPALHEPMYFFLSMLAASDLGLSASTFPTMMWLFWLNARELPFDICAAQ
MFFIHAFTYVESGVLLAMAFDRFVAIREPLHYATILTHSAMARMGAAILVRAVLLNLPGP
ILLRRLLFPQISVLSHCYCLHCDLVGLACSDTQINSLVGLVSILFSLGLDSFLIVLSYAL
ILRTVVSIASPGERLKALNTCVSHLCIVLIFYLPKLGLSVLHRVEKHNYPALAVLMANLH
FLVPPFMNPIVYCIKSKQIRQGLLKRFKRKRVDVS