Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51V18P Olfactory Receptor

Gene Symbol OR51V18P
Organism Dog
Family 51
Subfamily V
Pseudo Yes
Location chrUn_JH373332:12361-13302 (-)

Sequence information


Conceptual translation

MPAFPAYDTNSSTFLLTGFPGLEQEYPWLSIPFSCI*AMVLSGNCLVLHVIRTEPSLHQP
MFYFLAMLALTDLCMGLSTVHTVLGILWGLSQEVSLDACIAQTYFIHGLSLTESGVLLAM
ALDRFTAICNPLRYTSILTSARITKIGLGILVRSFVFIMAPIIRLKFFHYCHSHILSHSF
CLHQDLLRLACSDIRFNSF*ALALVICTLLFDSMLIIVSYILILHSVLAIASREERLKSL
QTCVSHICAVMVFYIPIIGLTMVHRFGKHLSPMVHVLMGNIYIIFPPLMNPIIYSVKTQQ
IRGRIQKWFSMKKE