Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51V19P Olfactory Receptor

Gene Symbol OR51V19P
Organism Dog
Family 51
Subfamily V
Pseudo Yes
Location chr21:28010439-28011380 ()

Sequence information


Nucleotide sequence

CTCCTTTTTCATGGAAAACCACTTCTGAATCCTGCCACGGATTTGTTGGGTTTTGACACT
GTAGATGATGGGGTTCATCAAGGGTGGGAAGATGATATAGATGTTGCCCATGAGGACATG
GACCATAGGAGAGAGGTGTTTCCCAAAACGATGCACCATAGTCAGACCGATTATTGGGAT
ATAGAAAACCATGACAGCACAGATATGGGAGACACAGGTCTGCAAGGACTTAAGCCGCTC
CTCCCGGGATGCAATAGCCAAGACAGAATGCAGGATCAGAATGTAGGATACAATAATTAG
CATGGAATCAAACAAAAGTGTGCAAATCACCAGAGCCAAGGCCTAGAAACTGTTAAAGCG
AATGTCAGAACATGCTAGTCTTAGTAAGTCTTGGTGAAGGCAAAAAGAGTGCGAGAGTAT
GTGGGAATGGCAATAGTGGAAAAACTTTAGGCGGATTATGGGAGCCATAATGAACACAAA
ACTCCTAACTAAAATTCCCAGCCCAATCTTGGTAATCCTGGCACTGGTTAGTATGGACGT
ATACCTCAGAGGGTTACAGATCGCTGTAAAGCGATCCAAAGCCATGGCGAGAAGGACTCC
AGACTCTGTGAGGGACAGACCATGGATGAAATAAGTTTGAGCAATGCAGGCATCCAGGCT
GACTTCCTGGCTAAGTCCCCACAGGATGCCCAGCACCGTGTGCACCGTGGACAGCCCCAT
GCACAGGTCAGTGAGGGCCAGCATGGCCAGGAAGTAGAACATGGGCTGGTGCAGGCTCGG
CTCAGTCCGGATCACATGCAGCACCAGGCAGTTCCCAGACAGTACCATAGCCTAGATACA
GGAGAAAGGGATGGACAGCCAGGGATATTCCTGTTCCAGGCCAGGGAAGCCTGTTAGTAG
AAAGGTGGAGGAATTGGTGTCATAAGCAGGAAAAGCAGGCAT


Conceptual translation

MPAFPAYDTNSSTFLLTGFPGLEQEYPWLSIPFSCI*AMVLSGNCLVLHVIRTEPSLHQP
MFYFLAMLALTDLCMGLSTVHTVLGILWGLSQEVSLDACIAQTYFIHGLSLTESGVLLAM
ALDRFTAICNPLRYTSILTSARITKIGLGILVRSFVFIMAPIIRLKFFHYCHSHILSHSF
CLHQDLLRLACSDIRFNSF*ALALVICTLLFDSMLIIVSYILILHSVLAIASREERLKSL
QTCVSHICAVMVFYIPIIGLTMVHRFGKHLSPMVHVLMGNIYIIFPPLMNPIIYSVKTQQ
IRGRIQKWFSMKKE