Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51V1CP Olfactory Receptor

Gene Symbol OR51V1CP
Organism Dog
Family 51
Subfamily V
Pseudo Yes
Location chr21:28,165,400-28,166,200 (-)
Aliases cOR51V9, cOR51V3

Sequence information


Nucleotide sequence

GCTAGTGTACTGTCTGGGAACTGCCTGGTGCTGCATGTGATCCGGACTGAGCCGAGCCTG
CACCAGCCCATGTTCTACTTCCTGGCCATGCTGGCCCTCACTGACCTGTGCATGGGGCTG
TCCACGGTGCACACGGTGCTGGGCATCCTGTGGGGGTTCATTCGAGAAATCAGCCTGGAT
TCGTGCATTGCCCAGTCCTACTTCATCCATGGTCTTTCCTTCATGGAGTCCTCTGTCCTC
CTTACTATGGCCTTTGATAGGTATGTCGCCATTTGCAATCCACTGCGGTATTCCTCCATT
CTGACTAATTCCAGGATTTTCAAAATCGGGCTCATCATAGTGGGTAGGAGTTTCTTCTTT
ATTACACCCCCCATCATCAATCTGAAATTTTTCCATTACTGTCATTCCCATAGCCTCTCT
CACTCGTTCTGCCTACACCAGGACCTTCTGCGTCTAGCTTGCTCAGACATCAGGTTTAAT
AGCTACTATGCCCTGATGTTGGTCATTCTCACGCTGTTGTTGGATGCTGTTCTCATCCTT
TACTCCTATGTGCTGATTCTTAGGGCAGTCCTGGCAATTGCCTCTCAGGAGGAACAGCAT
AAATTATTTCAGACCTGCATCTCCCACCTGTGTGCTGTTCTCGTGTTCTATATCCCTATC
ATTAGCTTAACAATGGTGCACCGTTTTGGCAAGCATCTCTCACCTGTGATCCATGTACTT
ATGGGCAACATCTACATCCTTTTCCCACCTTTGATGAACCCCATCATCTACAGTGTCAAG
ACCCAGCAGATTCGGAGCAGAATGCTCAGACTCTTT


Conceptual translation

ASVLSGNCLVLHVIRTEPSLHQPMFYFLAMLALTDLCMGLSTVHTVLGILWGFIREISLD
SCIAQSYFIHGLSFMESSVLLTMAFDRYVAICNPLRYSSILTNSRIFKIGLIIVGRSFFF
ITPPIINLKFFHYCHSHSLSHSFCLHQDLLRLACSDIRFNSYYALMLVILTLLLDAVLIL
YSYVLILRAVLAIASQEEQHKLFQTCISHLCAVLVFYIPIISLTMVHRFGKHLSPVIHVL
MGNIYILFPPLMNPIIYSVKTQQIRSRMLRLF