Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51V21 Olfactory Receptor

Gene Symbol OR51V21
Organism Dog
Family 51
Subfamily V
Pseudo No
Location chr21:28,059,500-28,060,400 (+)
Aliases cOR51X4

Sequence information


Nucleotide sequence

ATGTCTGTTCAATCTGTTTCCAAAGTCAATAACTTCACCTTTCTACTTACGGGATTCCCT
GGACTGGAGCAAGAATATCCCTGGCTGTCCATCCCTTTCTCCTGTATCTATGCTATGGTA
CTGTCTGGGAACTGCCTGGTGCTGCATGTGATCCGGACTGAACCGAGCCTGCACCAGCCC
ATGTTCTACTTCCTGGCCATGCTGGCCCTCACTGACCTGTGCATGGGGCTGTCCACAGTG
CACACGGTGCTGGGCATCCTGTGGGGGCTCAGCCAGGAGATAGGTCTGGATGCCTGCATT
GCTCAAACCTTCTTTGTTCATGGTCTGTCATGCATGGAGTCTGGAGTCCTTCTTGCCATG
GCCTTTGATCGCTTTACTGCCATCTGCAATCCTCTGAGGTATACATCCATCCTCACCAAT
ACCAGAATCATCAACATGGGCATGGCCATCGTAGGGAGGAGTTTCCTGTTCATCACTGCT
CCCATTGTCCGCCTAAAGTTCTTCCATTACTGCCGTCCTCATATCCTCTCCCACTCTTTC
TGCCTGCACCAGGACCTACTTCGGCTGGCCTGCTCTGACATTCGCTTCAACAGCTTCTAT
GCCTTAGCCCTGGTGATCTGCACACTGTTGTTGGATTCAGTGCTCATTCTCATCTCCTAC
GTCTTGATCCTGCACTCAGTTTTGACTATTGCATCCCGGGAGGAGCGCTTCAAGTCCTTG
CAGACCTGTGTCTCCCACATCTGTGCAGTGCTAGTTTTCTATATCCCAATCATTGGTCTG
ACCATGGTGCACCGCTTTGGAAAGCATCTGTCTCCTGTGGTCCATGTTCTCATGGGCAAC
ATCTATATCCTTTTCCCACCCTTGATGAACCCCATCATCTACAGTGTCAAAACCCAACAA
ATACGCAGCAGGTTCCAGAGATGGTTCACCAAACAAAAC


Conceptual translation

MSVQSVSKVNNFTFLLTGFPGLEQEYPWLSIPFSCIYAMVLSGNCLVLHVIRTEPSLHQP
MFYFLAMLALTDLCMGLSTVHTVLGILWGLSQEIGLDACIAQTFFVHGLSCMESGVLLAM
AFDRFTAICNPLRYTSILTNTRIINMGMAIVGRSFLFITAPIVRLKFFHYCRPHILSHSF
CLHQDLLRLACSDIRFNSFYALALVICTLLLDSVLILISYVLILHSVLTIASREERFKSL
QTCVSHICAVLVFYIPIIGLTMVHRFGKHLSPVVHVLMGNIYILFPPLMNPIIYSVKTQQ
IRSRFQRWFTKQN