Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51W1P Olfactory Receptor

Gene Symbol OR51W1P
Organism Dog
Family 51
Subfamily W
Pseudo Yes
Location chr21:27487689-27488233 (+)

Sequence information


Nucleotide sequence

ATGCACTACTGAAGCATCCTCACCAATGATGGTAATATTGGCTTGGGCTGCTTGCTACAA
AGTACAGGAGTTGTGATGCCCACCCCTATACTATTGAGGTGCTACCATCACTGTCGTGCT
AATGTCCTCAGCCACCCCTTTTGCTTGCATCAAGATATTCTGAAATTATCCTGCTATGAT
GCCAGTGTCAACAACATCTATGGATTGTGTGTAGTCATTATCACACTGGGCAGAGACTCA
TTCCTCATCCTCCTCTCTTATGTCCTAATTTTCCATGCTGTACTAGGCATTGCATCTAAT
GACAAGCAACTAAAGGCACTCAACACTTGTTTATTTCATGTATGTGTGGTGCTTATCTGC
TCTGTACCTCTAATAGGGGTATGCATGGTCCATCACTTTGGGAAGCACCTGCTTCCCATA
GTCCACATTCTCATGGCTGACATTTGCCTGCTTCTCCCACCAGTACTTAATCCCATCATC
TGCAGGTCAGGACCAAACAGATGCATTTTGGGATTTTCCACATGTTTAGGCAAAGTCAGA
GTCTT


Conceptual translation

MHY*SILTNDGNIGLGCLLQSTGVVMPTPILLRCYHHCRANVLSHPFCLHQDILKLSCYD
ASVNNIYGLCVVIITLGRDSFLILLSYVLIFHAVLGIASNDKQLKALNTCLFHVCVVLIC
SVPLIGVCMVHHFGKHLLPIVHILMADICLLLPPVLNPIICR/RTKQMHFGIFHMFRQS
QSL