Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52A1BP Olfactory Receptor

Gene Symbol OR52A1BP
Organism Dog
Family 52
Subfamily A
Pseudo Yes
Location chr21:28,097,400-28,098,300 (-)
Aliases cOR52A13P

Sequence information


Nucleotide sequence

ATGTCCATCTCCAACATTACAATCTTCATGCCTTCTGTGTTGACACTAATAGGGATCCCA
GGCCTAGAGTCTGTGCAGTGCTGGATTGGGATTCCATTCTGTGCCATGTATCACTTTGCT
ATGATTGGAAATTTCTTGCTTCTGATCATCATCAAATCAGAGCGCAGCCTCCATGAGCCC
ATGTATATTTTCTTAGGCATGTTAGGAGTCACAGATATTGTACCTGGCACAGGCATTGTG
CCCAAGATGCTTGGAATTTTTTGACTACATGTACCAGAGATTTATTTTGATTCCTGCTTG
CTTCAAATGGGGCTCATCCACACATTTGAGTGCATAGAGTCAGGCATCCTCCTTGCCATG
GCCCTGGACCGTTATGTGGCCATCTGTTATCCACTCAAACACAGTGGCATCTTCACCCAC
CAGCTGGTGGCCCAAATAGGGGCTATGGTAACACTCAGGGCTGCCATTCTGGTAGCCCCA
TCTTTAGCACTCATAAAGTGTCGGTTTCAATTTTATCATACAACCACCATCTCCCACTCC
TACTGTGAGCATATGGCCATTGTGAAACTGGCTGCAGAAAATGTGCGGGTCAACAAAATC
TATGACTTGTTTGTGGCATTTGCTGTTGCAGGGTTCGACCTCACCTTCATCACTATGTCC
TACATACAGATCTTCTTCACGGTTTTTCGTTTGCCCCAGAAGGAGCCCCACTTGAAAGCA
TTCAGTACCTGCATCGCCCACATCTGCGTTTTCCTCCAGCTCTACTTCCTTGCCTTCTTC
TCCTTCTTCACTCATAGGTTTGGTACTCATGTCCTCCTTATATCCATATCCTCTTTTCTA
GCCTCTACTTGCTGGTCCCCCCATTTCTTAATCCACTTGTCTATGGTGCCAAGACCAAGC
AAATCCGCATTCACGTGGTAAAGATG


Conceptual translation

MSISNITIFMPSVLTLIGIPGLESVQCWIGIPFCAMYHFAMIGNFLLLIIIKSERSLHEP
MYIFLGMLGVTDIVPGTGIVPKMLGIF*LHVPEIYFDSCLLQMGLIHTFECIESGILLAM
ALDRYVAICYPLKHSGIFTHQLVAQIGAMVTLRAAILVAPSLALIKCRFQFYHTTTISHS
YCEHMAIVKLAAENVRVNKIYDLFVAFAVAGFDLTFITMSYIQIFFTVFRLPQKEPHLKA
FSTCIAHICVFLQLYFLAFFSFFTHRF/YSCPPYIHILFSSLYLLVPPFLNPLVYGAKT
KQIRIHVVKM