Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52A6 Olfactory Receptor

Gene Symbol OR52A6
Organism Dog
Family 52
Subfamily A
Pseudo No
Location chr21:28,068,700-28,069,700 (-)
Aliases cOR52A6

Sequence information


Nucleotide sequence

ATGCCTATTACAAATGGCACCATGTTCATGCCCTCTGTGCTGATCTTCATTGGGATCCCT
GGTCTAGAAAGTATACAGTGTTGGATTGGGATTCCATTCTGTGCTATGTACGTCATTGCT
TTGGTGGGAAATTCTCTGCTATTGATCATCATCATATCTGAACCCAGTCTCCATGAGCCT
ATGTATATCTTTCTGGCCATGTTGGGAGCCACAGACATTGCACTTAGCACCATCTTTGTC
CCCAAGATGCTTGGAACTTTTTGGTTCCACTTGCCAGAGATCTTTTTTGATGTTTGCCTC
TTTCAGATGTGGCTCATCCACACATTTCAGGGTATTGAATCAGGAGTCCTGCTGGCTATG
GCTCTGGACCGCTATGTAGCAATCTGTTACCCTCTGAGGCATGCTACCATATTCACTCGA
CAACTAGTCACTCACATTGGAGTTGCAGTGACACTGCGGCCTGCCATTCTGGTCATCCCA
TGTCTGTTGCTCATAAAGTGTCGTCTGACACTTTATCGAACCAAGTTAATATCCCACACT
TACTGTGAACACATGGCCGTCGTGAAGCTTGCTGCTGAAGACGTTTACATTAATAAATTC
TATGGTCTCCTTGGGGCTTTTATTGTTGGTGGCCTGGACTTCATGTTGATTGCCCTCTCC
TATGTACAAATATTTATCACTGTCTTCCGCCTGCCTCAGAAAGAGGCACGTCTTAAAGCA
TTTAATACATGTATTCCCCACCTATGTGTCTTCTTCCAATTCTATCTCCTTGCTTTTTTT
TCCTTTTTCACTCACAGATCTGGATCTTATATTCCATCATACATACATATCACCCTGTCC
AACCTTTACCTACTGGTTCCACCTTTCTTCAATCCTCTTGTCTATGGGGTGAAGACCAAA
CACATCCGAGAGAAAGTAGTAAAAATGTTCCATTGCAAAGACCAGGTT


Conceptual translation

MPITNGTMFMPSVLIFIGIPGLESIQCWIGIPFCAMYVIALVGNSLLLIIIISEPSLHEP
MYIFLAMLGATDIALSTIFVPKMLGTFWFHLPEIFFDVCLFQMWLIHTFQGIESGVLLAM
ALDRYVAICYPLRHATIFTRQLVTHIGVAVTLRPAILVIPCLLLIKCRLTLYRTKLISHT
YCEHMAVVKLAAEDVYINKFYGLLGAFIVGGLDFMLIALSYVQIFITVFRLPQKEARLKA
FNTCIPHLCVFFQFYLLAFFSFFTHRSGSYIPSYIHITLSNLYLLVPPFFNPLVYGVKTK
HIREKVVKMFHCKDQV