Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52AC1 Olfactory Receptor

Gene Symbol OR52AC1
Organism Dog
Family 52
Subfamily AC
Pseudo No
Location chr21:28,795,900-28,796,800 (-)
Aliases cOR52AC1

Sequence information


Nucleotide sequence

ATGTTAATCTTCAACCATTCCAGCTTCCTGACCTTCACATTGATGGGCATACCAGGCTTA
GAGTCACAGCACTTGTGGTTATCTCTTCCTTTCTCCTCTATGTTTTTGGCTATTCTCATT
GGCAATGGTGCTATTCTCTTTCTGGTGGCCATAGAACCCACATTGCACAGTCCAATGTAT
CTGCTCCTGGCCTTGCTGATGGTGGCTGACCTCATATCTACTCTGGCACTGTTGCCCAAG
CTCCTCTGCCTCTTCTTGTTCAATGATCGGGACATAGCTGCCAATGCCTGCTTCACCCAG
ATGTTTTTCATCCATGGAACATCTGTGGTACGATCAGCCCTATTTGTGGCAATGGCCTTT
GACCGCTTCGTGGCTGTGTGTGAGCCTTTACGCTACAACACAATTCTGAGTCATTCCTTA
GTTGGACGCCTGGGACTGCTGGCTTTAGCCAAGGGTGTGATTCTTATCCTACCCATGCCT
CTTCTACTTCGAAGATTGACATTCTGCCAAATGGTCATTCCTCATACCTACTGTGACCAC
ATGGCTGTGGTGAAAATGGCCTGTGGCCATACAAGACCTAACCGTATCTATGGGCTCTTT
GTGATTCTTCTTGTGGTGGGACTTGATTTGCTGCTAATTGGTTTCTCTTATGGCCTCATC
TTGCAATCTGTGGTACGCCTCAACTCTCGAGATGCAACTTGCAAAGCCCTCAACACCTGT
TCAGCCCACTTCTTTGTCATTCTTGTCACTTATGTGCCTGCACTCTTTTCATCTCTCACT
CACCGCATAGGTCACAACATCCCACCTCATGCTCATGTTCTCCTTGCCAATCTTTATCTT
CTTCTACCCTCAGTACTCAACCCCATCATCTATGGCATAAAAATGAAGGAAATACGGCAC
AAGGTGGCCAAATGCCTTTGCAGAGGATCTGCA


Conceptual translation

MLIFNHSSFLTFTLMGIPGLESQHLWLSLPFSSMFLAILIGNGAILFLVAIEPTLHSPMY
LLLALLMVADLISTLALLPKLLCLFLFNDRDIAANACFTQMFFIHGTSVVRSALFVAMAF
DRFVAVCEPLRYNTILSHSLVGRLGLLALAKGVILILPMPLLLRRLTFCQMVIPHTYCDH
MAVVKMACGHTRPNRIYGLFVILLVVGLDLLLIGFSYGLILQSVVRLNSRDATCKALNTC
SAHFFVILVTYVPALFSSLTHRIGHNIPPHAHVLLANLYLLLPSVLNPIIYGIKMKEIRH
KVAKCLCRGSA