Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52AE1 Olfactory Receptor

Gene Symbol OR52AE1
Organism Dog
Family 52
Subfamily AE
Pseudo No
Location chr21:28,033,700-28,034,700 (-)
Aliases cOR52AE1

Sequence information


Nucleotide sequence

ATGGCAGACAATGCTACACATAGCTACATCTCATCTTTTTTCCTGGTTGGTATTCCTGGT
TTGCAAGCTTTTCACTGCTGGATTGGCATCCCTGTCTGCCTCCTGTTTGCCCTGGCCCTG
CTGGGGAACAGTGTAATCATCATCACCATCAAAATAGAACCCAGCCTCCACCTGCCTGTG
TATTTCTTCCTTTGTATGCTGGCAGTGAATGACATGGCTCTTGTCTCTTCCACAGCCCCC
AAGATGCTGGGTATCTTCTGGTTGGATGCTCACAAGTTTGACTTTAGTATCTGTCTAGCA
CAAATGTATTTTATCCACACATTCTGCATAATTGAGTCAGCCCTCTTGGTTGCCATGGCC
TTCGACCGGTATGTAGCTATTTGTATCCCACTGCGTTATACAACCATCTTGACAACACCA
ATGGTCACTAAAATGGGTCTAGCTGGTGTGATCCGAGCTACCTTTATGGTTTTGCCCTGT
CCTCTTCTTATTAAAAGGCTACCGTATTACACTAAATATGTTATCAATCATGCCTACTGT
GAGCACATGGCTGTGGTGAAGTTGGCCAGTGCCAACACCCTCATTAACAGAGCATATGGA
ATCTCTGTGGCCCTTTCAGTGATGGTGTTGGACCTAGGGCTCATCGCCACATCCTATATC
AAGATCCTTCAGGCAGTCTTCCGGCTATCTTCTCAGAATGCCCGCTCTAAAGCTCTGGGC
ACCTGTGCTGCCCATGTCTGCACTCTACTTGGATTCTACACACCTGCACTATTTAGTTTC
CTAACTCACCGTATTGGCAAGAAGGTACCTTCAAGCATTCATATAATCTTTGCAAGTTTG
TATCTTTTGGTGCCTCCCACAGTCAATCCCCTGGTGTATGGTGTCAAGACCAAACAGATT
CGTGACCGTGTGGTCAGTCTCTTCCTCTCAAACAAGATTATTTCTGGAAAC


Conceptual translation

MADNATHSYISSFFLVGIPGLQAFHCWIGIPVCLLFALALLGNSVIIITIKIEPSLHLPV
YFFLCMLAVNDMALVSSTAPKMLGIFWLDAHKFDFSICLAQMYFIHTFCIIESALLVAMA
FDRYVAICIPLRYTTILTTPMVTKMGLAGVIRATFMVLPCPLLIKRLPYYTKYVINHAYC
EHMAVVKLASANTLINRAYGISVALSVMVLDLGLIATSYIKILQAVFRLSSQNARSKALG
TCAAHVCTLLGFYTPALFSFLTHRIGKKVPSSIHIIFASLYLLVPPTVNPLVYGVKTKQI
RDRVVSLFLSNKIISGN