Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52B2 Olfactory Receptor

Gene Symbol OR52B2
Organism Dog
Family 52
Subfamily B
Pseudo No
Location chr21:29,504,600-29,505,600 (-)
Aliases cOR52B2P

Sequence information


Nucleotide sequence

ATGACTCACACCAACTTTACCATCTTCCACCCTGCAGTTTTTGTCTTACTGGGCATCCCT
GGGTGGGAGGCTTACCACATTTGGCTATCAGTACCCCTCTGCCTCATGTATATCACTGCT
GTCCTGGGGAACACCATCCTGATAGTGGTCATCATCACAGATCGTAATCTTCATGAGCCC
ATGTACTTCTTCCTCTCTATGCTGGCCATCACGGACATCCTGCTGTCTACCACTACTGTA
CCCAAAGCTCTAGCCATCTTTTGGCTCCATGCCCATAATATTGCTTTTGATGCTTGTGTC
ACCCAAGTTTTCTTTGTCCATGTGATGTTTGTAGGGGAGTCAGCCATCCTATTAGCTATG
GCCTTTGACCGCTTTGTGGCCATCTGTGCTCCCTTGCATTATACAACAGTGCTAACATGG
CGAGTTGTGGGAAGGATTGCTCTGGCCATTGTCACCCGAAGCTTTTGCATCATCTTCCCA
GTGATCTTCTTATTGAAGCGGCTGCCCTTCTGCCGGACCAACATCGTCCCCCATTCCTAT
TGTGAGCATATTGGAGTGGCCCGGTTGGCCTGTGCTGACATCACCATTAACATCTGGTAT
GGCTTCTCAGTGCCCATTGTCATGGTCATCTTGGATGTGATCCTCATTGCTGTGTCTTAC
TCACTGATCCTCCGAGCAGTGTTTCGTTTGCCCTCCCAGGATGCCCGGCACAAGGCCCTC
AGCACTTGTGGCTCCCACCTCTGTGTCATCCTCATGTTTTATGTTCCATCCTTCTTTACA
CTATTGACCCACCGCTTTGGACGTAACATTCCTCGACATGTCCATATCCTGCTGGCCAAT
CTTTATGTGGTGGTACCACCCATGCTCAACCCCATCGTCTATGGTGTGAAGACTAAGCAG
ATCCGGGAGGGTGTAGCCCACCGGTTTCTTGACATCAAGACTTGGTGCTGTGCTTCCCCT
CTGGGC


Conceptual translation

MTHTNFTIFHPAVFVLLGIPGWEAYHIWLSVPLCLMYITAVLGNTILIVVIITDRNLHEP
MYFFLSMLAITDILLSTTTVPKALAIFWLHAHNIAFDACVTQVFFVHVMFVGESAILLAM
AFDRFVAICAPLHYTTVLTWRVVGRIALAIVTRSFCIIFPVIFLLKRLPFCRTNIVPHSY
CEHIGVARLACADITINIWYGFSVPIVMVILDVILIAVSYSLILRAVFRLPSQDARHKAL
STCGSHLCVILMFYVPSFFTLLTHRFGRNIPRHVHILLANLYVVVPPMLNPIVYGVKTKQ
IREGVAHRFLDIKTWCCASPLG