Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52B4 Olfactory Receptor

Gene Symbol OR52B4
Organism Dog
Family 52
Subfamily B
Pseudo No
Location chr21:26,720,400-26,721,400 (-)
Aliases cOR52B7

Sequence information


Nucleotide sequence

ATGACTGCCTTAAACCACACTGCTGTTAGCCACACAGTCTTCCACTTGCTGGGTATCCCT
GGGCTAGAAGACCAGCACATGTGGATTTCCATTCCCTTCTTCATTTCCTACGTCATCGCC
CTGCTTGGGAACAGCCTGCTCATCTGCATTATCCTCACGAAGCGCAGCCTCCATGAACCC
ATGTACCTCTTCCTCTGCATGCTGGCTGGAGCAGACATTGTCCTCTCCACCTGCACAGTA
CCACAGGCCTTGGCCATCTTCTGGTTCCATGCTGGGGAGATCTCCTTGGATCGCTGCATT
ACTCAGCTCTTCTTCATCCATACCACCTTCATCTCTGAGTCAGGGATCTTGCTGGTGATG
GCCTTTGACCGCTACATTGCCATATGCTACCCACTGAGATACACCACTATTCTTACAGGT
GCACTGATTGGGAAAATCGGTGTGACCATCTTCCTGAGAAGTTATGGTACAATTTTCCCC
ATAATATTTCTTTTGAAAAGATTGACCTTCTGCCAAAATAATATTATTCCACATACCTAC
TGTGAACACATTGGTTTGGCCAAATATGCTTGTAATGACATTTATGCTAACATCTGGTAC
GGATTTTCCATCCTAATGTTAACAGTAGTTTTAGATGTTGTGCTAATTTTTGTTTCCTAT
GTGATGATTCTCCGTGCTGTCTTCTGCATCCCTTCTCGAGATGCTCGCCATAAAGCTCTC
AACACTTGTGGCTCCCATGTCTGCATTATCATCCTCTTTTATGGGCCTGGAATCTTCACA
ATCCTTACTCAACGTTTTGGATGCCACATTCCACCTCATACCCACATCTTGTTGGCTAAT
GTTTGCATGCTTGCCCCACCTATGCTCAATCCCATCATTTATGGGATCAAGACCAAGCAA
ATCCGGGAGCAGGTGGTTCATGTATTGTTTACAAGGCAGAAATCACTTTGGTTTAGGAAC


Conceptual translation

MTALNHTAVSHTVFHLLGIPGLEDQHMWISIPFFISYVIALLGNSLLICIILTKRSLHEP
MYLFLCMLAGADIVLSTCTVPQALAIFWFHAGEISLDRCITQLFFIHTTFISESGILLVM
AFDRYIAICYPLRYTTILTGALIGKIGVTIFLRSYGTIFPIIFLLKRLTFCQNNIIPHTY
CEHIGLAKYACNDIYANIWYGFSILMLTVVLDVVLIFVSYVMILRAVFCIPSRDARHKAL
NTCGSHVCIIILFYGPGIFTILTQRFGCHIPPHTHILLANVCMLAPPMLNPIIYGIKTKQ
IREQVVHVLFTRQKSLWFRN