Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52B4BP Olfactory Receptor

Gene Symbol OR52B4BP
Organism Dog
Family 52
Subfamily B
Pseudo Yes
Location chr21:28,622,100-28,623,100 (+)
Aliases cOR52B8P

Sequence information


Nucleotide sequence

ATGACTGCCTTAAACCACACTGCTGTTAGTCACACAGTCTTCCAGTTGTTGGGTATCCCT
GGGCTAGAAGACCAGCACATGTGGATTTCCATCCCCTTCTTCATTTCCTACGTCATTGCC
CTGCTTGGGAACAGCTTGCTCATCTGCATTATCCTCACAAAGTGCAGCCTCCATGAACCC
ATGTACCTCTTCCTCTGAATGCTGGCCGGAGCAGACGTTGTCCTCTCCACGTGCACAGTA
CCCCAGGCCTTGGCCATCTTCTGGTTCCGTGCTGGGGAGATCTCCTTGGATCGCTGCATC
ACTCAGTTCTTCATCATACATTGCACTTTCATGTCTGAGTCAGGGATATTGCTGGTGATG
GCCTTTGACCGCTACATTGCCATATGCTACCCACTGAGATACACCACTATTCTTACACAA
GCACTGATTGGGAAAATCGTGTGACTGTCTTTCTGAGAAGTTTTTGTACACTTTTCCCCA
TAATATTTCTTTTGAAAAGATTGACTTTCTGCCAAAATAATACCATTCCACACACCTTTT
GTGAACACATTGGCTTGGCCAAATATGCTTGTAATGACATTCAAGTGAACATCTGGTATG
GATTTTCCATCCTAATGTTAACAGTGGTTTTAGATGTAGTGCTAATTTTTGTTTCCTATG
TGCTGATTCTCCATGCTGTCTTCCACATCCCTTCTCAAGATGCTCGCCACAAAGCCCTCA
ACACCTGTGGTTCCCACATCTGTGTCATCATCCTTTTTTATGGGCCTGGAATCTTCACAA
TCCTTACTCAACGGTTTGGACGCCACATTCCACCTCATACCCACATCTTGTTGGCTAATG
TTTGCATGCTTGCCCCACCTATGCTCAATCCCATCATTTATGGGATCAAGACCAAGCAAA
TCCGGGTGCAGGTGGTTCATGTGTTGTTCACAAAGCAGAAATCACTTTGGTTTAAA


Conceptual translation

MTALNHTAVSHTVFQLLGIPGLEDQHMWISIPFFISYVIALLGNSLLICIILTKCSLHEP
MYLFL*MLAGADVVLSTCTVPQALAIFWFRAGEISLDRCITQFFIIHCTFMSESGILLVM
AFDRYIAICYPLRYTTILTQALIGKIV*LSF*EVFVHFS/IIFLLKRLTFCQNNTIPHT
FCEHIGLAKYACNDIQVNIWYGFSILMLTVVLDVVLIFVSYVLILHAVFHIPSQDARHKA
LNTCGSHICVIILFYGPGIFTILTQRFGRHIPPHTHILLANVCMLAPPMLNPIIYGIKTK
QIRVQVVHVLFTKQKSLWFK