Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52B6 Olfactory Receptor

Gene Symbol OR52B6
Organism Dog
Family 52
Subfamily B
Pseudo No
Location chr21:28,583,400-28,584,400 (+)
Aliases cOR52B6

Sequence information


Nucleotide sequence

ATGGCCCTTTCATCTGCCACCAGCCCAGCTGCTGTGAATGACTCTGACACTCGAGTGGCC
GGCTGCCTCCTCATTGGCATCCCTGGGCTGGAGCATCTGCACATCTGGCTCTCCATCCCC
TTCTGTACTATGTATGCAGCTGCCCTGGCAGGCAATGGCATTTTAATTTGTGTCATCCTC
TCCCAGCCAAGCCTGCATGAGCCTATGTACATATTCCTGTCCATGTTGGCCAGTGCGGAT
ATCTTGCTCTCCACTTCCACCATGCCCAAAGCACTGGCCAACTTCTGGCTGGGTTCAAGC
CATATTTCCTTCGATGGCTGCCTCACCCAGATGTTCTTCATCCATTTCCTCTTCGTGGCT
GACTCTGCGGTCCTGCTGGCCATGGCCTTTGACCGCTTTGTGGCTATCTGCTACCCTCTG
CGATATTCCACAATCCTGACGAAGACGGTCATTGGGAAGATCGTTGCTGCCACCCTGACC
CGCAGCTTCATCATCATGTTTCCATCAGTCTTTCTTCTCAAGCGCCTGCACTATTGCCGG
ATAAACATCATTGCACACACTTTTTGTGAGCACATGGGCATCGCCCGTCTGTCCTGTTCT
GATATCTCCATCAATATCTGGTATGGGTTGGCAGCTGCTCTACTCTCCACAGGCCTGGAC
ATCATCCTTATCACTGTTTCCTACATTCACATCCTCCAAGCTGTCTTCCACCTCCCTTCT
CAAAATGCCCGGTCCAAGGCCCTGAGCACGTGTGGCTCCCATGTCTGTGTCATCCTACTC
TTCTATATCCCTGCCCTCTTCTCTGTCTTTGCCTACAGATTTGGTAGGAAACGCATCCCA
CGCTATGTCCATATCCTCTTGGCTAACCTCTATGTGGTCATCCCACCTATGCTCAATCCC
ATTATTTATGGAGTGAGGACCAAGCAGATTTGGGAAGGGGTTAAACAGATGTTTTCACAT
CTTGTCCAGGAATCTAAA


Conceptual translation

MALSSATSPAAVNDSDTRVAGCLLIGIPGLEHLHIWLSIPFCTMYAAALAGNGILICVIL
SQPSLHEPMYIFLSMLASADILLSTSTMPKALANFWLGSSHISFDGCLTQMFFIHFLFVA
DSAVLLAMAFDRFVAICYPLRYSTILTKTVIGKIVAATLTRSFIIMFPSVFLLKRLHYCR
INIIAHTFCEHMGIARLSCSDISINIWYGLAAALLSTGLDIILITVSYIHILQAVFHLPS
QNARSKALSTCGSHVCVILLFYIPALFSVFAYRFGRKRIPRYVHILLANLYVVIPPMLNP
IIYGVRTKQIWEGVKQMFSHLVQESK