Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52B9 Olfactory Receptor

Gene Symbol OR52B9
Organism Dog
Family 52
Subfamily B
Pseudo No
Location chr21:26,733,300-26,734,300 (+)
Aliases cOR52B9

Sequence information


Nucleotide sequence

ATGGCTAGCTTCAATCACACTGGTGTTAACCATGTAGTCTTCTACCTGCTGGGCATTCCA
GGCCGAGAAGACCTACACATATGGATTTCCATTCCCTTCCTCATCTCCTATATCTTTGCC
CTCCTTGGAAATGGTTTGCTTATCTTCATTATCCTCACCAAGAGCAGCCTCCATGAACCT
ATGTATCTTTTTCTCTGCATGCTGGCTGGAGTTGACATTGTCTTTGCCACAACCACAGAA
CCCAAGGCATTGGCCATTTTCTGGTGTAATAGTAGGAAGATCTCTCTTAATAGCTGCATT
GCCCAGCTCTACTTCCAGCATTCCTCCTTTATTACTGAGTCAGGCATCTTGCTGATTATG
GCATTTGACCGCTACATTGCAATATGTTACCCACTAAGGTACACCATGATACTCACTCAC
TCTCTGATAGGGAAAATTGGTGTGGCTGTTTTCTTGAGAGCACATTGTACAATTTTTCCT
ATGATATTCCTATTGAAGAGGCTGACTTTTTGCAGAAATAACATCCTACCACATACATTC
TGTGAACACATTGGCTTGGCCAAGTATGCCTGTGATGATATCCGAGTAAACATCTGGTAT
GGATTTTTTGTCCTAATGTCAACAGTGATTCTAGATATTGTCCTCATTTTTGTTTCCTAT
GCTCTGATCCTCCATGCTGTCTTCCTTTTCCCTTCACGAGATGCTCGCCACAAAGCTCTC
AACACCTGCGGTTCCCATGTCTGTGTCATCATTCTTTTTTATGGGCCTGGGATCTTCTCG
GTTCTCACTCAGCGCTTTGGCCATCACATCCCGCTACATGTCCACATCCTGTTGGCCAAT
GTCAGCATGCTTGCTCCACCTATGCTGAACCCCATCATTTATGGGGTCAAAACAAAACAG
ATACGAGACCAAGTGATTTATGTGTTGTTTCCAAAGCAGAAA


Conceptual translation

MASFNHTGVNHVVFYLLGIPGREDLHIWISIPFLISYIFALLGNGLLIFIILTKSSLHEP
MYLFLCMLAGVDIVFATTTEPKALAIFWCNSRKISLNSCIAQLYFQHSSFITESGILLIM
AFDRYIAICYPLRYTMILTHSLIGKIGVAVFLRAHCTIFPMIFLLKRLTFCRNNILPHTF
CEHIGLAKYACDDIRVNIWYGFFVLMSTVILDIVLIFVSYALILHAVFLFPSRDARHKAL
NTCGSHVCVIILFYGPGIFSVLTQRFGHHIPLHVHILLANVSMLAPPMLNPIIYGVKTKQ
IRDQVIYVLFPKQK