Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52D1 Olfactory Receptor

Gene Symbol OR52D1
Organism Dog
Family 52
Subfamily D
Pseudo No
Location chr21:28,458,100-28,459,100 (-)
Aliases cOR52D1

Sequence information


Nucleotide sequence

ATGTCAACCTCCAACCTCAGTGATGACAGTCTTCCAGCCATCATGTTCCTGACAGGAATC
CCAGGGCTGGAGTGGGCTCATGCCTGGATTGCCATCCCCTTCTGTGCCATGTATCTGGTA
GCACTGGCTGGGAATGCTGCCCTCATCCTGGTCATTGTGACAGACAGTGCTCTTCATGCA
CCCATGTACCTCTTCCTGTGTCTTCTCTCATTCACTGACCTGGCTCTCAGCTCAACCACC
GTGCCCAAAATGCTAGCCATTTTGTGGCTCCATGCTGGAGAAATTTCCTTTGGTGGATGC
CTGGCCCAGATGTTTTGTGTCCATTCTATCTATGCTCTGGAGTCCTCAGTTCTTCTGGCC
ATGGCCTTTGATCGCTATGTAGCTATCTGCAACCCACTGAGATACACAACCATTCTTAAC
CATACTGTAATAGGCAAAATTGGCCTTGTTGGCCTCCTCCGCAGCGTGGCCATTGTCTCC
CCATTTATCTTCCTGCTGAGGCGACTGCCTTACTGTGATCACCATGTCATGGCACATACA
TACTGTGAGCACATGGGCATCGCTCGCCTGGCCTGTGGCAACATCACTGTCAATATTGTC
TATGGGCTGACTGTGGCCCTGCTGGCCATGGGTCTGGATTCCATCCTCATTGCCATTTCC
TATGGCTTTATCCTCCACGCTGTCTTCCGCCTTCCATCTCAAGATGCCAGGCACAAGGCT
CTGAGTACCTGTGGCTCCCACCTCGGGGTCATCCTGGTCTTCTACATTCCTGCCTTCTTC
TCCTTCCTCACCCATCGTTTTGGCCAGCACCGAGTTCCCAAGAATGTGCACATCTTTCTG
GCGAACCTCTATGTGCTGGTGCCTCCTGTGCTCAATCCAATCATCTATGGAGCTAGGACC
AAGGAGATTCAGAGTCGACTGCTGAGATTCCTTCACTTGGGGAAAATTTTAATG


Conceptual translation

MSTSNLSDDSLPAIMFLTGIPGLEWAHAWIAIPFCAMYLVALAGNAALILVIVTDSALHA
PMYLFLCLLSFTDLALSSTTVPKMLAILWLHAGEISFGGCLAQMFCVHSIYALESSVLLA
MAFDRYVAICNPLRYTTILNHTVIGKIGLVGLLRSVAIVSPFIFLLRRLPYCDHHVMAHT
YCEHMGIARLACGNITVNIVYGLTVALLAMGLDSILIAISYGFILHAVFRLPSQDARHKA
LSTCGSHLGVILVFYIPAFFSFLTHRFGQHRVPKNVHIFLANLYVLVPPVLNPIIYGART
KEIQSRLLRFLHLGKILM