Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52D1C Olfactory Receptor

Gene Symbol OR52D1C
Organism Dog
Family 52
Subfamily D
Pseudo No
Location chr21:28,471,700-28,472,600 (-)
Aliases cOR52D4

Sequence information


Nucleotide sequence

ATGTCAACCTCTAACCTCAGTGATGACAGTCTTCCAGCCATCATGTTCCTGACGGGAATC
CCAGGGCTGGAGTGGGCTCATGCCTGGATTGCCATCCCCTTCTGTGCCATGTATCTGGTA
GCACTGGCTGGGAATGCTGCCCTCATCCTGGTCATTGTGACAGACAGTGCTCTTCATGCA
CCCATGTACCTCTTCCTGTGCCTTCTCTCACTCACTGACTTGGCTCTCAGCTCCACCACC
GTGCCGAAGACATTAGCAATTTTGTGGCTCCATGCTGGAGAAATTTCCTTTGGTGGATGC
CTGGCCCAGATGTTTTGTGTCCATTCTATCTATGCTCTGGAGTCCTCAGTTCTTCTGGCC
ATGGCCTTTGATCGCTATGTGGCTATTTGCAACCCACTGAGATATATGATCATCCTCAAC
CGTAGCATCATAGGCAGAATTGGCCTTACTGGCATACTCCGTAGTATCGCTGTTGTCTCC
CCGTTCATTTTCTTGCTGAGGCGACTGCCTTACTGTGGTCACCATGTCATGGCACATACA
TATTGTGAGCACATGGGCATTGCTCGCCTGGCCTGTGGCAACATCACTGTCAATATTGTC
TATGGGCTGACTGTGGCCCTGCTAGCTGTGGGTCTGGATTCCATCCTCATTGCCATTTCC
TATGGCTTTATCCTCCACGCTGTCTTCCGCCTTCCATCTCAAGATGCCAGGCACAAGGCT
CTGAGTACCTGTGGCTCCCACCTCGGGGTCATCCTGGTCTTCTACATTCCTGCCTTCTTC
TCCTTCCTCACCCATCGTTTTGGCCAGCACCGAGTTCCCAAGAATGTGCACATCTTTCTG
GCGAACCTCTATGTGCTGGTGCCTCCTGTGCTCAATCCAATCATCTATGGGGCTAGGACC
AAGGAGATTCGGAGTCGGCTTCTGAGACTGCTTCACTTGGGGAAGGTCTCAGTG


Conceptual translation

MSTSNLSDDSLPAIMFLTGIPGLEWAHAWIAIPFCAMYLVALAGNAALILVIVTDSALHA
PMYLFLCLLSLTDLALSSTTVPKTLAILWLHAGEISFGGCLAQMFCVHSIYALESSVLLA
MAFDRYVAICNPLRYMIILNRSIIGRIGLTGILRSIAVVSPFIFLLRRLPYCGHHVMAHT
YCEHMGIARLACGNITVNIVYGLTVALLAVGLDSILIAISYGFILHAVFRLPSQDARHKA
LSTCGSHLGVILVFYIPAFFSFLTHRFGQHRVPKNVHIFLANLYVLVPPVLNPIIYGART
KEIRSRLLRLLHLGKVSV