Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52D3 Olfactory Receptor

Gene Symbol OR52D3
Organism Dog
Family 52
Subfamily D
Pseudo No
Location chr21:28,739,200-28,740,200 (+)
Aliases cOR52D3

Sequence information


Nucleotide sequence

ATGCTTTCTGCATCGGTCACCAATGACACTGCCTTCCATCCCTCCACATTTATTCTACTT
GGAATCCCTGGGATGCAAGACCAGCACATGTGGGCTGCCATACCCTTCTGCTCCATGTAT
ATCCTTGCTCTGGTTGGCAATGGCACCATCCTCTACATCATCATGACAGATAGAACTCTG
CATGAGCCAATGTACCTCTTCCTGTGCCTACTTTCTATCACCGACCTGATTCTCTGTTCT
ACCACACTGCCCAAGATGCTAACAATCTTCTGGCTCAGGTCCCACATAATTTCCTACCAT
GGCTGTCTCACACAAATGTTTTTTGTTCACACTATCTTTGCCACAGAGTCAGCAGTTCTA
CTGGCCATGGCTTTTGACCGCTATGTGGCTATCTGCCGTCCGCTTCATTATACATCCATC
CTCAATGCTACAGTGATTGGGAAGATTGGTCTGGCATGTGTGGTCCGTGGTCTTCTCTTT
GTCTTCCCCTTTGTTATCCTCATCGAACGCTTACCCTTCTGTGGACATCACATCATCCCC
CACACCTACTGTGAGCACATGGGCATTGCCAAGCTGGCTTGTGCCAGCATCAAGCCCAAC
ACCATTTATGGTCTCACTGTGGCACTTTCAGTCACTGGCATGGATGTGGTCCTCATTGCC
ACCTCCTATGGCCTGATCCTTCGGGCAGTGCTGCGCCTACCCTCCAAGGATGCCCAATTC
CGAGCATTTAGCACTTGTGGAGCTCACATTTGTGTGATTCTTGTTTTCTATGTACCTGCC
TTTTTTTCCTTTTTCACCCACCGCTTTGGCCACCAAGTACCTCCTCATGTCCACATTGTA
CTTGCAAATCTCTACCTTCTTGTGCCCCCTGTTCTCAACCCCCTGGTCTATGGCATTAAT
ACCAAACAGATCCGTCTGAGAATATTTGGCTTTTTTATGGGAAGGAGG


Conceptual translation

MLSASVTNDTAFHPSTFILLGIPGMQDQHMWAAIPFCSMYILALVGNGTILYIIMTDRTL
HEPMYLFLCLLSITDLILCSTTLPKMLTIFWLRSHIISYHGCLTQMFFVHTIFATESAVL
LAMAFDRYVAICRPLHYTSILNATVIGKIGLACVVRGLLFVFPFVILIERLPFCGHHIIP
HTYCEHMGIAKLACASIKPNTIYGLTVALSVTGMDVVLIATSYGLILRAVLRLPSKDAQF
RAFSTCGAHICVILVFYVPAFFSFFTHRFGHQVPPHVHIVLANLYLLVPPVLNPLVYGIN
TKQIRLRIFGFFMGRR