Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52E15 Olfactory Receptor

Gene Symbol OR52E15
Organism Dog
Family 52
Subfamily E
Pseudo No
Location chr21:29,016,900-29,017,800 (-)
Aliases cOR52E15

Sequence information


Nucleotide sequence

ATGTCTCCAGCCAATACATCATGTATTCACCCCTCATCCTTCCTGCTGTTGGGAATCCCA
GGACTGGAAAATATGCAGTTCTGGCTTGGTATCCCATTTGGTACGGTGTATCTGATTGCC
CTCCTGGGGAATGTCATCATCCTTTTTGTGATTCAGACTGAGCACAGCCTTCACCAACCC
ATGTTCTACTTATTGGCCATGTTGGCTCTCACTGACCTGGGCCTCTCCACTGCCACCATT
CCCAAAATGCTGAGCATTTTCTGGTTCGGCTTCAGTGAGATTGCCTTTGGGGGATGCTTA
GCTCAAATGTTCTTCATACACCTGTTTACAGGCTTTGAAACATTCATGCTTGTAGCCATG
GCTTTTGATCGCTATGTTGCCATTTGCCACCCTCTTCGATACAACACAATCCTCACCAAC
AGAACTATTTGTATTATTGCTGGAGTAGGAATGCTGAAAAATTTTGCTTTGGTGCTTCCA
CTTGTGTTTCTCCTTCTAAGGCTTTCATTCTGTGGGAATAATATTATACCTCATTCCTAT
TGTGAGCACATGGGCATTGCCCGCCTGGCCTGTGTCAGCATAAAGGTCAATGTATTATTT
GGATTAATCCTCATCTCTATGATACTTTTGGATGTTGTTTTGATTGCTCTCTCCTATGTG
AAGATTCTACATGCTGTCTTCAGACTCCCTTCCTGGGAGGCTAGGCTCAAAGCTCTTAAT
ACCTGTGGTTCCCATGGATGTGTCATCTTAGCTTTTTTCACTCCAGCATTTTTCTCCTTT
ATGACTCATCGATTTGGCCACAATATTCCACGTTACATCCACATCCTCTTGGCTAATTTG
TATGTAATCATCCCTCCTGCTCTTAACCCCATTATTTATGGGGTGAGAACCAAACAGATC
CGAGAGCAGGTAGTGATGATCTTCCTTTTTAAGGAAGTT


Conceptual translation

MSPANTSCIHPSSFLLLGIPGLENMQFWLGIPFGTVYLIALLGNVIILFVIQTEHSLHQP
MFYLLAMLALTDLGLSTATIPKMLSIFWFGFSEIAFGGCLAQMFFIHLFTGFETFMLVAM
AFDRYVAICHPLRYNTILTNRTICIIAGVGMLKNFALVLPLVFLLLRLSFCGNNIIPHSY
CEHMGIARLACVSIKVNVLFGLILISMILLDVVLIALSYVKILHAVFRLPSWEARLKALN
TCGSHGCVILAFFTPAFFSFMTHRFGHNIPRYIHILLANLYVIIPPALNPIIYGVRTKQI
REQVVMIFLFKEV