Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52E18P Olfactory Receptor

Gene Symbol OR52E18P
Organism Dog
Family 52
Subfamily E
Pseudo Yes
Location chr21:29,010,700-29,011,600 (+)
Aliases cOR52E18P

Sequence information


Nucleotide sequence

ATGTCCCCCTCAAATGATACCAAGTCTCATCCCTCCTATTTCCTCCTACTGGGAGTTCCA
GGCCTTGAAGAGATGCACATCTGGATTGGGTTTCCTTTTTGTTTTGTGTATTTGATTGCC
CTTGTGGGAAACATCATTATCCTGTTTGTGATCAAGAATGAACACAGTCTTCATCAGCCT
ATGTTTTACTTCTTGGCCATGTTAGCCTCCATTGATGTGGGTCTATCGACATCCACTATC
CCCAAAATGTTGGGCATATTCTGGTTTAATTTAAAAGAGATTAGTTTTGATGGCTGTGTC
ACCCAAATGTTCTTTATTCATATATTCACTGCCATGGAGACTGTTGCATTGGTGGCCATG
GCCTTTGACCGCCATGTTACCATCTGCAATCCTCTGAGATACAGCCTGATTCTCACGAAC
AGGATGATTTGTCTCATCCTTGTTGTGGTGTTTGGTGTCAATTTCATTTTGGTTATCCCT
CTGGTGTTTCTTATTTTGAGGCTTTCCTTCTGTGGACACCATATAATCCCACATACATAC
TGTGAGCACATGGGAATTGCTCGGCTGGCCTGTGCCAGTATAAAAGTAAATATGATATTT
GGATTATTTCTTGTATCAGTGGTGTTTGTTGATGTTGTTCTGATTGTCATTTCCTATGTG
AAAATACTCTGAGCTGTCTTCTGCCTTTCTTCTCAGGATGCCAGACTCAAGGTACTTAAT
ACATGTGGCTCCCATATCTGTATTATTCTAGCCTTCTTCACTCCAGCTTTTTTCTCTGTC
TTGACCCATCGTTTTGGCAGGGATGTTCCCATATACATATACATTCACATTCTCCTGGCC
AATCTATATGTTGTTGTTCCACCTGCCCTCAATCCTCTCATCTATGGAGTAAGGACAAAG
CAAATTCGGGAAAGGGTTTCAAGTATCTTTTGGAAAAAAGACTGATATTAGCT


Conceptual translation

MSPSNDTKSHPSYFLLLGVPGLEEMHIWIGFPFCFVYLIALVGNIIILFVIKNEHSLHQP
MFYFLAMLASIDVGLSTSTIPKMLGIFWFNLKEISFDGCVTQMFFIHIFTAMETVALVAM
AFDRHVTICNPLRYSLILTNRMICLILVVVFGVNFILVIPLVFLILRLSFCGHHIIPHTY
CEHMGIARLACASIKVNMIFGLFLVSVVFVDVVLIVISYVKIL*AVFCLSSQDARLKVLN
TCGSHICIILAFFTPAFFSVLTHRFGRDVPIYIYIHILLANLYVVVPPALNPLIYGVRTK
QI/GKGFKYLLEKRLILA