Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52E25 Olfactory Receptor

Gene Symbol OR52E25
Organism Dog
Family 52
Subfamily E
Pseudo No
Location chr21:29,083,400-29,084,300 (+)
Aliases cOR52E25, cOR52E9

Sequence information


Nucleotide sequence

ATGCTGCATTCCAACAATACACAGTTCCATCCTCCCTCCTTCCTTCTGGTGGGGATTCCA
GGACTACAAGATGTGCACATCTGGATTGGCTTCCCCTTTTTTGCAGTGTATCTGATAGCC
CTTCTGGGGAACATCACTATCCTGTTCGTGATCCAGATGGAACATAGCCTCCACCAACCC
ATGTTTTACTTCCTGGCCATGTTGGCCTGCACTGACCTTGGCTTGTCCACAGCCACCATC
CCCAAGATGCTGGGCATTTTCTGGTTCAATCTCAGGGAGATTGGGTTTGGTGCTTGCATC
ACACAGATGTACACTATCCATATATGTACCGGCCTGGAGTCTGTGGTGCTGACAGTTATG
GCCATAGATCGATATATTGCCATCTGCAACCCCTTGAGATATAGCATGATCCTTACCAAT
AAGGTGATAGCTATCCTGAGCATAGTCATCATAGTCAGGACTTTGGTGTTTGTGACTCCA
TTCATATTTCTCATCCTGAGATTGCCTTTCTGTGGTGTCCGGGTTATCCTTCATACCTAC
TGTGAACATATGGGCTTGGCAAAGTTGGCTTGTGCCAATATTAGGGTCAATGTTGTGTAT
GGATTGATTGCTTTCTCAGTGGGATACATTGATCTATCTGTGATTGGATTCTCCTACGTC
CAAATCCTCCGAGCAGTCTTCCACCTCCCCTCCTGGGATGCCCGGCTCAAGGCACTCAAC
ACATGTGGCTCGCATGTCTGTGTCATGTTAGCTTTCTACCTGCCAGCCCTCTTCTCCTTC
ATGACACATCGCTTTGGCCACAACATTCCTCATTACATCCACATTCTTCTGGCCAATCTG
TACGTGGTTGTTCCCCCTGCTCTTAACCCTGTTATCTATGGGGTCAGGACAAAACAGATA
AGAGAGCGTGTACTAAGGATACTTATCCCTAAAGCCTAT


Conceptual translation

MLHSNNTQFHPPSFLLVGIPGLQDVHIWIGFPFFAVYLIALLGNITILFVIQMEHSLHQP
MFYFLAMLACTDLGLSTATIPKMLGIFWFNLREIGFGACITQMYTIHICTGLESVVLTVM
AIDRYIAICNPLRYSMILTNKVIAILSIVIIVRTLVFVTPFIFLILRLPFCGVRVILHTY
CEHMGLAKLACANIRVNVVYGLIAFSVGYIDLSVIGFSYVQILRAVFHLPSWDARLKALN
TCGSHVCVMLAFYLPALFSFMTHRFGHNIPHYIHILLANLYVVVPPALNPVIYGVRTKQI
RERVLRILIPKAY