Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52E4 Olfactory Receptor

Gene Symbol OR52E4
Organism Dog
Family 52
Subfamily E
Pseudo No
Location chr21:29,056,800-29,057,800 (-)
Aliases cOR52E4

Sequence information


Nucleotide sequence

ATGACTTCCATCAATGACACTCAGTTCCATCCCCCCTTCTTTCACCTGCTAGGAATCCCA
GGGCTGGAAACTGTCCGCATCTGGATTGCTTTCCCATTCTGTGTTGTGTATCTGATTGCC
CTCGTGGGGAACATCTCCATCCTGTTTGCAATCAAGACTGAACACAGTCTCCACCAGCCC
ATGTTCTACTTCCTGGCCATGTTGTCTATGATCGATCTGGGTCTGTCCACGTCCACCATC
CCCAAAATGCTGAGCATCTTCTGGTTCAACCTCCAAGAGATCAGCTTCAGGGGCTGCCTT
ACTCAGATGTTCTTCATCCACATGTTCACAGGCATGGAGACTGTTCTCCTGGTGGCCATG
GCTTATGACCGCTTTGTTGCCATCTGCAACCCTCTCCAGTACACCATGATCCTCACCAAT
AAAACAATCGGCATCCTCGCCTCTGTTGTTGTTGGAAGAAATTTAATTCTGGTGACTCCA
TTTGTGTTTCTCATTCTGAGGCTGCCCTTCTGTGGGCATCACGTCATCCCTCATACGTAC
TGTGAGCACATGGGTCTTGCCTGGTTGGCCTGTGCACCCATCAAGGTCAACATTATCTAT
GGGCTCATGGTGATTTCCAATATCATTGTGGATGTGATCCTGATTGCTTCGTCCTATGTG
CTTATCCTTCAAGCTGTTTTCCGCCTTCCTTCTCAGGATGCCCGACTAAAGGCTCTCAAT
ACCTGTGGTTCTCATGTCTGTGTCATGCTGTACTTTTACACACCGGCATTTTTTTCTTTC
ATGACACACCGTTTTGGTCGAAACATCCCCCGCTATATCCATATCCTTTTAGCTAATCTA
TATGTGGTTGTCCCACCTGCCCTCAACCCAGTCATCTATGGAGTCAGGACCAAGCAGATC
CGAGAGACAGTTGTGAAGATATTTGTACAGAAA


Conceptual translation

MTSINDTQFHPPFFHLLGIPGLETVRIWIAFPFCVVYLIALVGNISILFAIKTEHSLHQP
MFYFLAMLSMIDLGLSTSTIPKMLSIFWFNLQEISFRGCLTQMFFIHMFTGMETVLLVAM
AYDRFVAICNPLQYTMILTNKTIGILASVVVGRNLILVTPFVFLILRLPFCGHHVIPHTY
CEHMGLAWLACAPIKVNIIYGLMVISNIIVDVILIASSYVLILQAVFRLPSQDARLKALN
TCGSHVCVMLYFYTPAFFSFMTHRFGRNIPRYIHILLANLYVVVPPALNPVIYGVRTKQI
RETVVKIFVQK