Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52E8C Olfactory Receptor

Gene Symbol OR52E8C
Organism Dog
Family 52
Subfamily E
Pseudo No
Location chr21:29,039,600-29,040,500 (-)
Aliases cOR52E12, cOR52E10

Sequence information


Nucleotide sequence

ATGCCAGAAAGAATGGCTACACCTAATGATACCCAGTTCCATCCCTCTTCGTTCCTCCTC
CTGGGTATCCCAGAACTAGAAGATGTGCAGTTCTGGATCGGATTTCCCTTTTTCTTTGTG
TATCTTGTTGCACTCCTGGGGAATGCTGCTGTCCTATTTGTGATCCAGACTGAGCATAGT
CTCCATGAGCCCATGTACTACTTTCTGGCCATGTTGGACTCCATTGACCTGGGCTTGTCC
ACAGCCACCATCCCCAAAATGTTGGGCATCTTCTGGTTCAGCCTCAGAGATATATCTTTT
GAAAGCTGTCTTTCCCAGATGTTCTTCATCCATTTCTTCACTGTCATGGAGAGCATTGTG
TTGGTGGCCATGGCCTTTGACCGCTACATTGCCATTTGTAAACCTCTTCGGTACACCATG
ATCCTCACCAGCAAAATCATCATCATCATTGCAGGCATTGCTATTCTGAGGAGTCTTTGC
ATGGTGATCCCACTGGTGTTTCTCCTCCTGAGGCTGCCCTTCTGTGGGCACCATATCATC
CCTCATACCTATTGTGAACACATGGGCATTGCCCGTCTGGCTTGTGCCAGCATCAAAGTC
AACATTCTATTTGGCCTTGGCAACATTTCTCTCTTATTATTGGATGTGCTCCTTATAATT
CTCTCCTATGTCAGGATCCTCCATGCTGTCTTCTGTTTGCCCTCCAGGGAGGCTCGACTC
AAAGCTCTCAACACCTGTGGCTCCCACATTGGTGTTATCTTAGCCTTTTTCACTCCAGCC
TTTTTCTCTTTCTTGACACATCGATTTGGCCACAATATTCCTCAATATATTCACATTTTC
TTGGCTAATCTGTATGTAGTTGTTCCACCAGCTTTCAATCCTGTAATTTATGGGGTCAGG
ACCAAGCAGATCAGGGAGCGAGTCCTGAGGGTTTTCTTTAGGACAGAGAGC


Conceptual translation

MPERMATPNDTQFHPSSFLLLGIPELEDVQFWIGFPFFFVYLVALLGNAAVLFVIQTEHS
LHEPMYYFLAMLDSIDLGLSTATIPKMLGIFWFSLRDISFESCLSQMFFIHFFTVMESIV
LVAMAFDRYIAICKPLRYTMILTSKIIIIIAGIAILRSLCMVIPLVFLLLRLPFCGHHII
PHTYCEHMGIARLACASIKVNILFGLGNISLLLLDVLLIILSYVRILHAVFCLPSREARL
KALNTCGSHIGVILAFFTPAFFSFLTHRFGHNIPQYIHIFLANLYVVVPPAFNPVIYGVR
TKQIRERVLRVFFRTES