Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52E8D Olfactory Receptor

Gene Symbol OR52E8D
Organism Dog
Family 52
Subfamily E
Pseudo No
Location chr21:29,029,200-29,030,100 (-)
Aliases cOR52E16

Sequence information


Nucleotide sequence

ATGTCCACTCTTAATGATACCCAATTTCACCCTTCTTCATTCCTACTCTTGGGTATACCA
GGGCTAGAAGATGTGCATTTCTGGATCGGATTTCCCTTTTTCTTTGTGTATCTTGTTGCA
CTCCTGGGGAATACTGCTGTCCTATTTGTGATCCTGACTGAGCATAATCTCCATGAGCCC
ATGTACTACTTTCTGGCCATATTGGACTGCATTGACCTGGGCTTATCCACAGCCACCATC
CCCAAAATGTTGGGCATCTTCTGGTTCAGCCTCAGAGATATATCTTTTGAAAGCTGTCTT
TCTCAGATGTTCTTCATCCATTTCTTCACTGCCATGGAGAGCATTGTGTTGGTGGCCATG
GCCTTTGACCGCTACATTGCCATTTGTAAACCTCTTCGGTACACCATGATCCTCACCAAC
AGAATCATCATCATCATTGCAGGCATTGCTATTCTGAGGAGTCTTTGCATGGTGATCCCA
CTGGTGTTTCTCCTCCTGAGGCTGCCCTTTTGTGGGCACCACATCATCCCTCATACCTAT
TGTGAACACATGGGCATTGCCCGTCTGGCTTGTGCCAGCATCAAAGTCAACATAATATTT
GGTCTTGGGGATATGTCTATTTTATTATTGGATGTGCTTCTTATTACTCTTTCCTATGTC
AGGATCCTCCATGCTGTCTTCTGCTTGCCCTCCAAGGAGGCTCGACTCAAAGCTCTCAAC
ACCTGTGGCTCCCACATTGGTGTTATTTCAGCCTTTTTCACTCCAGCATTTTTCTCTTTC
TTGACACATCGTTTTGGCCACAACATCCCCCAGTATATCCACATTTTTTTAGCCAATCTA
TACATCGTTGTTCCACCAGCTCTCAATCCTGCAATCTACGGGGTCAGGACCAAGCAGATT
AGAGAGCGGGTTTTGAGGATTTTTTTTAAAGACATT


Conceptual translation

MSTLNDTQFHPSSFLLLGIPGLEDVHFWIGFPFFFVYLVALLGNTAVLFVILTEHNLHEP
MYYFLAILDCIDLGLSTATIPKMLGIFWFSLRDISFESCLSQMFFIHFFTAMESIVLVAM
AFDRYIAICKPLRYTMILTNRIIIIIAGIAILRSLCMVIPLVFLLLRLPFCGHHIIPHTY
CEHMGIARLACASIKVNIIFGLGDMSILLLDVLLITLSYVRILHAVFCLPSKEARLKALN
TCGSHIGVISAFFTPAFFSFLTHRFGHNIPQYIHIFLANLYIVVPPALNPAIYGVRTKQI
RERVLRIFFKDI