Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52H1B Olfactory Receptor

Gene Symbol OR52H1B
Organism Dog
Family 52
Subfamily H
Pseudo No
Location chr21:28,402,300-28,403,200 (+)
Aliases cOR52H8P

Sequence information


Nucleotide sequence

ATGTCTGCCATGATCATTTTCAACCTGAGCAATTACAACCCAGGACCCTTCATTCTGGTG
GGAATCCCCGGCCTGGAGCATTGCTATGTGTGGATTGGGATTCCCTTCTGTATCATCTAT
GTTGTGGCCCTCGTGGGAAACTGTACCCTTCTCTACCTCATCACAGTGGAACGTAGCCTT
CATGAACCCATGTTTTTCTTTCTCTCCATGCTGGCCATGACTGATCTCATCCTGTCCACA
GCTGGTGTTCCCAAATCACTCAGTATCTTTTGGCTTGGGGCTCGAGAAATCACATTCCCA
GGGTGTCTTACACAAATGTTCTTCCACCACTGTAGCTTTGTCCTAGATTCAGCCATCTTG
ATGGCCATGGCATTTGATCGCTATGTGGCCATCTGCTCCCCCCTGAGATATACCACTATT
CTGACCCCCAGGACCATCACCAAGATTGCAGTGGGCATCTCCTTTCGAAGCTTCTGCATC
ATCCTGCCTGATGTATTCTTGCTTACACGTTTGCCTTTCTGCAGGACACGCATCATACCA
CACACATACTGTGAGCACATAGGTGTGGCCCGGCTCGCCTGTGCTGACATCTCCATCAAC
ATCTGGTATGGCTTTTGTGTTCCCATCATGACAGTCATCTCAGATGTGATTCTCATTGCC
GTTTCTTACACCCTCATCCTCTGTGCGGTCTTCCGCCTGCCCTCCCGAGATGCCCGCCAG
AAGGCCCTTGGCACCTGTGGTTCCCATGTCTGTGTCATCCTCATGTTCTATATACCAGCA
TTCTTCTCCATTCTTGCCCATCGCTTTGGCCATAATGTCCCTCGTACTTTTCACATCCTC
TTTGCCAACCTCTATATTGTTATTCCACCTGCACTCAACCCCATTGTCTATGGAGTAAAG
ACCACACAGATCCGACATAAGGTCATCCTTTTGTTTTCTACCAAGGGTTCAGAA


Conceptual translation

MSAMIIFNLSNYNPGPFILVGIPGLEHCYVWIGIPFCIIYVVALVGNCTLLYLITVERSL
HEPMFFFLSMLAMTDLILSTAGVPKSLSIFWLGAREITFPGCLTQMFFHHCSFVLDSAIL
MAMAFDRYVAICSPLRYTTILTPRTITKIAVGISFRSFCIILPDVFLLTRLPFCRTRIIP
HTYCEHIGVARLACADISINIWYGFCVPIMTVISDVILIAVSYTLILCAVFRLPSRDARQ
KALGTCGSHVCVILMFYIPAFFSILAHRFGHNVPRTFHILFANLYIVIPPALNPIVYGVK
TTQIRHKVILLFSTKGSE