Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52H9 Olfactory Receptor

Gene Symbol OR52H9
Organism Dog
Family 52
Subfamily H
Pseudo No
Location chr21:28,713,700-28,714,800 (+)
Aliases cOR52H9

Sequence information


Nucleotide sequence

ATGTGTATTAATAAATGTATAAAAGAAATGAAGTGGGGCCACTGGCAAAGAAAAGGGGTA
ATAAAAAGTCAATTCTATAGGTGTCAACATCCAGGGGGCAGAGGGGACTCTCAGGCAAGA
TGCCTGAATGCGACAGTTGCAGTCACCTACCATGGTCAGTCCCAGCCCATTCTATCGCTA
ATGTGTCCTCAGGGCCCCAAAGCCAGTGGATCCCAGACTGAGGAGACCATGTATAATCTG
AGCTGTTACGATCCTGGTTCCTTTATCCTTGTGGGGATACCTGGCCTGGAGAAGTTTCAC
ATCTGGATCGGGATTCCCTTTTGTGTCATCTATGTTCTGGCTCTTGTGGGTAACTGCACC
CTCCTCTACCTCATTGCAGTGGAGCACAGCCTCCATGAGCCCATGTTTTTCTTCCTAGCT
ATGCTGGCTACCACGGACCTCATCCTGTCCACTGCCACAGTGCCCAAACTGCTCACTAAC
CTCTGGCTGCACTCCCAGGAAATAACCTTCTCTGGCTGTCTCACCCAGATGTTTTTCCTC
CACTTCAGCTTTGTAGTCGACTCAGCCATCCTGTTGGCCATGGCATTTGATCGCTACGTT
GCCATCTGCTTCCCCTTGAGGTACACCACCATCCTGACTCCTCAGGTGATCATCAAGCTT
GCAGCGAGCATTGTTGTGAGGAGCTTCTCTGTCATCTTGCCAGATGTTTTTCTGCTGAAA
CGGTTACCCTTCTGTGGGACACGCATCATACCACACACATACTGTGAGCACATAGGTGTT
GCTCGGCTTGCCTCTGCTGACATCTCCATCAACATCTGGTATGGCTTTTCTGTGCCTCTT
ATGACTGTCATCTCAGATGTGATCATTATTGCTGTTTCCTATACCTTCATCCTCCGTGCT
GTCTTTCAGCTCTCATCTCAGGGTGCCCGCCAGAAGGCCCTCAGCACTTGTGGTTCTCAT
GTCTGTGTCATTCTCATGTTTTACACACCTGCCTTCTTCTCCATCCTTGCCCATCGCTTT
GGGCATAGTGTCCCTCGAAATGTGCTTATCCTGTTTGCCAACCTCTATGTGGCCATCCCC
CCCGCTCTCAATCCTATTGTCTATGGAGTGAAGACTAAGCAGATCCAGGACAAATTTATT
CTCCTCTTCTCTTTGAAGAAGACACAA


Conceptual translation

MCINKCIKEMKWGHWQRKGVIKSQFYRCQHPGGRGDSQARCLNATVAVTYHGQSQPILSL
MCPQGPKASGSQTEETMYNLSCYDPGSFILVGIPGLEKFHIWIGIPFCVIYVLALVGNCT
LLYLIAVEHSLHEPMFFFLAMLATTDLILSTATVPKLLTNLWLHSQEITFSGCLTQMFFL
HFSFVVDSAILLAMAFDRYVAICFPLRYTTILTPQVIIKLAASIVVRSFSVILPDVFLLK
RLPFCGTRIIPHTYCEHIGVARLASADISINIWYGFSVPLMTVISDVIIIAVSYTFILRA
VFQLSSQGARQKALSTCGSHVCVILMFYTPAFFSILAHRFGHSVPRNVLILFANLYVAIP
PALNPIVYGVKTKQIQDKFILLFSLKKTQ