Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52K1 Olfactory Receptor

Gene Symbol OR52K1
Organism Dog
Family 52
Subfamily K
Pseudo No
Location chr21:26,866,100-26,867,100 (+)
Aliases cOR52K6

Sequence information


Nucleotide sequence

ATGACAGTGTTCAATATCACCACAACCCATCCAGCTTCCTTCCTGCTGGTAGGAATTCCA
GGTTTGGAGCAATTGCATGTCTGGATCTCCATTCCATTCTGCTTTGCCTATACTCTGGCC
CTGCTAGGCAACTGCACCCTTCTCTTCATTATTCAGGCTGATGCAGCCCTCCATGAGCCC
ATGTACTTCTTTCTGGCCATGTTGGCAGCCATTGACCTGGTCCTCTCTTCTACAACACTT
CCCAAAATGCTGGCTATTTTTTGGTTCAGAGATCGGGAGATCAGCTTCTATGGCTGTCTG
GTCCAGATGTTCTTTCTCCACTCCTTCTCTATCATGGAGTCAGCAGTGCTGCTGGCCATG
GCCTTTGACCGCTATGTGGCCATCTGCAAGCCATTGCACTACACCACAGTCCTGACTAGG
CCCCTGATCACCAAGATTGGCATGGCAGCTGTGGCTCGGGCTGTGACATTAATGACTCCG
CTCCCCTTTCTGCTCAGACGCTTCCACTACTGCCGAGGCACCATGATTGCCCACTGCTAC
TGTGAGCATATGGCTGTGGTGAGGCTGGCCTGTGGGGATACTCGCTTCAACAATATCTAT
GGCATTGCTGTGGCCATGTTTATAGTGGTGTTGGACCTGCTGTTTGTTATCTTGTCTTAC
ATCTTCATCCTTCGGGCAGTTTTACAGCTTGCCTCTCAAGAGGCCCGCTACAAGGCCTTT
GGGACATGTGTATCTCACATAGGTGCCATCTTATCTACCTACACACCTGTGGTCATCTCC
TCAGTCATGCATCGTGTGGCTCGCCGGGCTGCCCCTCATGTCCACATACTACTTGCTATT
TTCTATCTTCTTTTTCCGCCCATGATCAATCCCATCATCTATGGTGTCAAGACCAAGCAG
ATTCGTGATCATGTGCTCAATCTGTTCCAGAGAAAGAAAGTG


Conceptual translation

MTVFNITTTHPASFLLVGIPGLEQLHVWISIPFCFAYTLALLGNCTLLFIIQADAALHEP
MYFFLAMLAAIDLVLSSTTLPKMLAIFWFRDREISFYGCLVQMFFLHSFSIMESAVLLAM
AFDRYVAICKPLHYTTVLTRPLITKIGMAAVARAVTLMTPLPFLLRRFHYCRGTMIAHCY
CEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSYIFILRAVLQLASQEARYKAF
GTCVSHIGAILSTYTPVVISSVMHRVARRAAPHVHILLAIFYLLFPPMINPIIYGVKTKQ
IRDHVLNLFQRKKV