Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52K1B Olfactory Receptor

Gene Symbol OR52K1B
Organism Dog
Family 52
Subfamily K
Pseudo No
Location chr21:26,847,200-26,848,200 (+)
Aliases cOR52K5, cOR52K4

Sequence information


Nucleotide sequence

ATGGCCATGTCAGCCTCCAATATCAGCTCAACCTATCCGGCACTCTTCATGTTGATGGGG
ATCCCAGGCCTGGAGCACCTGCATAACTGGATCTCCATTCCATTCTGCTTTGCCTATACT
CTGGCCCTGCTAGGCAACTGCACCCTTCTCTTCATTATTCAGGCTGATGCAGCCCTCCAT
GAGCCCATGTACTTCTTTCTGGCCATGTTGGCAGCCATTGACCTGGTCCTCTCTTCTACA
ACACTTCCCAAAATGCTGGCTATTTTTTGGTTCAGAGATCGGGAGATCAGCTTCTATGGC
TGTCTGGTCCAGATGTTCTTTCTCCACTCCTTCTCTATCATGGAGTCAGCAGTGCTGCTG
GCCATGGCCTTTGACCGCTATGTGGCCATCTGCAAGCCATTGCACTACACCACAGTCCTG
ACTAGGCCCCTGATCACCAAGATTGGCATGGCAGCTGTGGCTCGGGCTGTGACATTAATG
ACTCCGCTCCCCTTTCTGCTCAGATGCTTCCACTACTGCCGAGGCACCATGATTGCCCAC
TGCTACTGTGAGCATATGGCTGTGGTGAGGCTGGCCTGTGGGGATACTCGCTTCAACAAT
ATCTATGGCATTGCTGTGGCCATGTTTATAGTGGTGTTGGACCTGCTGTTTGTTATCTTG
TCTTACATCTTCATCCTTCGGGCAGTTTTACAGCTTGCCTCTCAAGAGGCCCGCTACAAG
GCCTTTGGGACATGTGTATCTCACATAGGTGCCATCTTAGCCTTTTACACACCTGTGGTC
ATCTCCTCAGTCATGCATCGTGTGGCTCGCCGGGCTGCCCCTCATGTCCACATACTTTTT
GCTAATTTCTATCTGCTCTTCCCGCCCATGATCAATCCCATCATCTATGGTGTGAAGACC
AAGCAGATTCGTGAGCGGGTCTTAGGACTATTCCAAAGAAAGGATGCA


Conceptual translation

MAMSASNISSTYPALFMLMGIPGLEHLHNWISIPFCFAYTLALLGNCTLLFIIQADAALH
EPMYFFLAMLAAIDLVLSSTTLPKMLAIFWFRDREISFYGCLVQMFFLHSFSIMESAVLL
AMAFDRYVAICKPLHYTTVLTRPLITKIGMAAVARAVTLMTPLPFLLRCFHYCRGTMIAH
CYCEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSYIFILRAVLQLASQEARYK
AFGTCVSHIGAILAFYTPVVISSVMHRVARRAAPHVHILFANFYLLFPPMINPIIYGVKT
KQIRERVLGLFQRKDA