Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52L1 Olfactory Receptor

Gene Symbol OR52L1
Organism Dog
Family 52
Subfamily L
Pseudo No
Location chr21:29,421,300-29,422,200 (-)
Aliases cOR52L4

Sequence information


Nucleotide sequence

ATGATGACCTTTAGTAATTCTAGCTGGAGGCTACTCCAGCCTTCTTTTTTTCTGATGGGC
ATCCCCGGTTTAGAGGAAAGCCAGCACTGGATAGCATTGCCACTGTGTGTCCTTTATGTC
CTTGCTGTAATGGGCAATGTCACCATCATCTTCATCATCTGGACTGACTCATCCTTGCAC
CAGCCGATGTACCTCTTTCTGGCCATGCTATCTGGCATTGACCTGGTGCTGGCCTCCTCC
ACTGCACCCAAAACCCTTGCGGTGCTCCTGGCTCATGCCCATGAGATTGGGTACACTTTC
TGCCTGATCCAGATGTTCTTCATCCATGCGTTCTCTTCCATGGAGTCAGGGGTACTTGTG
GCCATGGCTCTGGATCGCTATGTAGCCATTTGTCACCCTCTGCATCATTCCACCATCTTG
CATCCGGGGATCATCGGGCGCATTGGGATGGCAGTGCTGGTGCGGGGGTTAGTCCTCCTC
CTCCCCTTCCCTATCCTGTTGCAGAGACTCCTCTTCTGCCGGGCCACCATCATAGGCCAT
GCCTATTGTGAACATATGGCTGTTGTAAAACTTGCCTGCTCAGAAACCACAGTGAACCGA
GCTTATGGGTTGGCAGTGGCCCTGCTTGTGGTTGGGCTAGATGTCGTGGCCATTGGTATT
TCCTATGCCTTCATCCTGCAGACAGTGCTGAAGGTACCAGGGGGTGAGGCCCGACTTAAG
GCCTTTAGCACATGTGGGTCTCATATTTGTGTTATCCTGATCTTCTATGTTCCTGGAATA
TTCTCCTTCCTCACACATCGTTTTGGCCACCATGTACCCCACCACGTCCATGTTCTTCTG
GCCACACTCTACCTCCTTGTGCCACCTGCACTCAATCCTCTTGTCTATGGGGTGAAGACT
CAACAGATCCGCCAGCGAGTACTTAGGGTTTTCTCCCTAAAAGGA


Conceptual translation

MMTFSNSSWRLLQPSFFLMGIPGLEESQHWIALPLCVLYVLAVMGNVTIIFIIWTDSSLH
QPMYLFLAMLSGIDLVLASSTAPKTLAVLLAHAHEIGYTFCLIQMFFIHAFSSMESGVLV
AMALDRYVAICHPLHHSTILHPGIIGRIGMAVLVRGLVLLLPFPILLQRLLFCRATIIGH
AYCEHMAVVKLACSETTVNRAYGLAVALLVVGLDVVAIGISYAFILQTVLKVPGGEARLK
AFSTCGSHICVILIFYVPGIFSFLTHRFGHHVPHHVHVLLATLYLLVPPALNPLVYGVKT
QQIRQRVLRVFSLKG