Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52M2 Olfactory Receptor

Gene Symbol OR52M2
Organism Dog
Family 52
Subfamily M
Pseudo No
Location chr21:26,889,000-26,890,000 (-)
Aliases cOR52M5

Sequence information


Nucleotide sequence

ATGTTCATGTCTAATAATGCCTGTTTGGTGCCTAGTTCTTTCTGGCTTACTGGTATTCCA
GGGCTGCAATCCCTGCACATCTGGCTCTCCATCCCCTTCAGCTCTATGTACCTGATGGCT
ATAGTGGGGAATGTGACTATCCTGGCAGTGATAAAGGTGGAACGCAGCCTGCACCAACCC
ATGTACTTCTTCCTGTGCATGTTGGCTGTCATTGACTTGGTCCTTTCAACGTCTACCATG
CCCAAACTACTAGCCATCTTCTGGTTTGGTGCCCACAACATTGACCTGGATGCCTGCTTG
GCTCAGATGTTCTTCATCCACTGCTTTGCCACTGTTGAGTCAGGAATCTTCCTTGCCATG
GCTTTTGATCGCTATGTGGCCATATGTGACCCATTACGCCACACCTTGGTGCTCACTCAT
GCAGCAGTGGGTCGTTTGGGCTTGGCTGCCCTCTTCCGTGGAGTACTCTACATTGGGCCT
CTGCCTCTGATGATTCGCCTGAGGCTGCCTCATTACCAGACCCAAATCATTGCCCATTCC
TATTGTGAGCACATGGCCATAGTTACCTTAGCATGTGGTGACACAACAGTCAACAACTTG
TATGGAATGGGAATTGGCTTCCTGGTATTGATCCTAGATTCATTAGCTATCACTGCCTCA
TATGTGATGATTTTCAGGGCTGTAATGGGGTTGGCCACCCCAGAGGCCAGGCTTAAAACT
CTAGGGACATGTAGTTCTCACATTTGTGCCATTCTTGTCTTCTATATCCCCATTGCTGTT
TCTTCTCTCACTCACCGCTTTGGCCATCATGTGCCTCCTCATATCCATATCCTTTTGGCC
AACTTTTACCTCCTCATTCCACCCATTCTCAACCCAGTTGTCTATGCTGTCCGTACCAAA
CAGATTCGAGAGAGACTTCTCTACATTCTTAAGGCAGGGTCTCAACCCAAG


Conceptual translation

MFMSNNACLVPSSFWLTGIPGLQSLHIWLSIPFSSMYLMAIVGNVTILAVIKVERSLHQP
MYFFLCMLAVIDLVLSTSTMPKLLAIFWFGAHNIDLDACLAQMFFIHCFATVESGIFLAM
AFDRYVAICDPLRHTLVLTHAAVGRLGLAALFRGVLYIGPLPLMIRLRLPHYQTQIIAHS
YCEHMAIVTLACGDTTVNNLYGMGIGFLVLILDSLAITASYVMIFRAVMGLATPEARLKT
LGTCSSHICAILVFYIPIAVSSLTHRFGHHVPPHIHILLANFYLLIPPILNPVVYAVRTK
QIRERLLYILKAGSQPK