Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52M6P Olfactory Receptor

Gene Symbol OR52M6P
Organism Dog
Family 52
Subfamily M
Pseudo Yes
Location chr21:26,929,400-26,930,300 (+)
Aliases cOR52M6P

Sequence information


Nucleotide sequence

GAGTCCCTATATATCTGGCTTTCCATCCCCCTCAGCTCCATTTACCTGGTTGCTGTGGTG
GGGAATGTCACCATTCTGGCTGTGGTAAAGGTGGAGCATAGCCTGCATCAGCCCATGTAT
TTCTTCCTGTGTGTTTTGGCCGTCATTGACCTGGTTCTGTCTACTATGCCCAAAATGCTG
GGAATCTTCTGGTTTGGCGCTGGGAACATTGGCCTGGATGCCTGCCTGGCTCAAGTGTTC
CTCATCCACTACTTTGCCACAGTGAGTCCAGCATCTTCCTTGCTGTAACTTTTAACCACT
GTGTAGCCATCTGTAACCTACTCTGTTCCACTACAGTATGAGTGAGCACTGTGGTGTGAT
GTTTGGGGGTGGCTGCCCTCCTCTGGGGTATACTCTACATTAGACCCCTGCCTTTGATAA
TCCACCTGTGGCTACTCCTTTACAAAGCTCATGTCATCTCCCACGCCTACTGTGAGCACA
TGGATGTGAGCACCTTGGTTGTGGTGACAGCAGGGTCAACAATGTCTATGGGCTGAGCTT
TGGCTTTCTGGTCCTGATCCTGGAACCAACAGCCATTGCTGCCTCTTATATGATGATTTT
CTGGGCTGTGGTGGGACTGGCCACACCTGAGGCCAGGCTTAAAACCCTGGGGACATGTGG
TTCTCACATCTGTACCATTCTGATCTTTTATGTTCATATTGCCGTTTCTTCTCTCATTCA
TCGATTTGGTCACCAGGTGCCTCCTCCAATCCACACTCTAGTGGCCAGCTTCTACCTCCT
CATTCCTTCAATCCTCAATCCCACTGTCTATGCTGTCTGCATCAAGCAGATCTGAGAGAG
GCTTCTCCAAATCCTGAAGATAGAAACTAAGATCAAA


Conceptual translation

G/ESLYIWLSIPLSSIYLVAVVGNVTILAVVKVEHSLHQPMYFFLCVLAVIDLVLSTMP
KMLGIFWFGAGNIGLDACLAQVFLIHYFATVS/SIFLAVTFNHCVAICNLLCSTTV*VS
TVV*CLGVAALLWGILYIRPLPLIIHLWLLLYKAHVISHAYCEHMDVSTL/CGDSRVNN
VYGLSFGFLVLILEPTAIAASYMMIFWAVVGLATPEARLKTLGTCGSHICTILIFYVHIA
VSSLIHRFGHQVPPPIHTLVASFYLLIPSILNPTVYAVCIKQI*ERLLQILKIETKIK