Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52N2 Olfactory Receptor

Gene Symbol OR52N2
Organism Dog
Family 52
Subfamily N
Pseudo No
Location chr21:28,980,400-28,981,400 (+)
Aliases cOR52N2

Sequence information


Nucleotide sequence

ATGTGTGGGGAAAACAGCTCCAGCCTGGCCCCAGGATTCTTTGTCTTGAATGGTATCCCT
GGGCTGGAAGCTGCACACACCTGGATCACCCTGCCATTCTGCTTCATGTACATCACCGCT
GTCCTGGGGAACTGTGGGCTCATCTACCTCATCAGCCATGAGGAGGCCCTGCATCGGCCC
ATGTACTACTTCCTGGCCCTGCTCTCCTTCACAGATGTCACCCTGTGCACCACCACGGTA
CCCAATATGCTGTGCATATTCTGGTTCAACCTCAAGGAGATTCACTTTAATGCCTGCCTG
GCTCAGATGTTTTTTGTCCATATGCTGACTGGGATGGAGTCTGGGGTGCTCATGCTCATG
GCCCTGGACCGCTACGTGGCCATCTGCCACCCCTTACGTTATTCCACCATCCTCACCAAC
CCTGTCATCACCAAGGCAGGTCTTGCCACGTTCCTGAGGGGTGTGCTGCTCATCCTCCCA
TTCACATTCCTCACCAAGCGTCTGCCCTATTGCCGAAGCAACTTTATTCCCCATACCTAC
TGTGACCACATGTCTGTGGCCAAGGTGTCCTGTGGCAATTTCAAGGTCAATGCTATCTAT
GGCTTAATGGTTGCTCTCCTTATTGGTGTGTTTGATATATGCTGTATTTCTGTGTCTTAC
ACTATGATATTGAGGGCAGTAGTGAGCCTGTCATCTGCAGATGCTCGTCACAAAGCCTTC
AGCACCTGCACATCCCACATATGTGCTATTGTCATCACTTATGTTCCAGCTTTTTTCACA
TTTTTTGCCCACCGTTTTGGAGGACACAATATCCCCCACCACATACACGTCATTGTAGCC
AACATTTACTTGCTACTGCCTCCTACAATGAACCCAATTGTTTATGGAGTTAAGACCAAG
CAGATCCGGGAAGGTGTGATCAAGTTTTTAGTTGGAGATAGGTTGTCTTTACCCAAGACA
AATAAATCA


Conceptual translation

MCGENSSSLAPGFFVLNGIPGLEAAHTWITLPFCFMYITAVLGNCGLIYLISHEEALHRP
MYYFLALLSFTDVTLCTTTVPNMLCIFWFNLKEIHFNACLAQMFFVHMLTGMESGVLMLM
ALDRYVAICHPLRYSTILTNPVITKAGLATFLRGVLLILPFTFLTKRLPYCRSNFIPHTY
CDHMSVAKVSCGNFKVNAIYGLMVALLIGVFDICCISVSYTMILRAVVSLSSADARHKAF
STCTSHICAIVITYVPAFFTFFAHRFGGHNIPHHIHVIVANIYLLLPPTMNPIVYGVKTK
QIREGVIKFLVGDRLSLPKTNKS