Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52N2G Olfactory Receptor

Gene Symbol OR52N2G
Organism Dog
Family 52
Subfamily N
Pseudo No
Location chr21:28,968,900-28,969,800 (+)
Aliases cOR52N9

Sequence information


Nucleotide sequence

ATGTGTGGGGAAAACAGCTCCAGCCTGGCCCCAGGATTCTTTGTCTTGAATGGTATCCCT
GGGCTGGAAGCTGCACACACCTGGATCGCCCTGCCATTCTGCTTCATGTACATCATCACT
GTCCTGGGGAACTGTGGGCTCATCTACCTCATCAGCCATGAGGAGGCCCTGCATCAGCCC
ATGTACTACTTCCTGGCCCTGCTCTCCTTCACAGATGTCACCCTGTGCACCACCACGGTA
CCCAATATGCTGTGCATATTCTGGTTCAACCTCAAGGAGATTCACTTTAATGCCTGCCTG
GCTCAGATGTTTTTTGTCCATATGCTGACTGGGATGGAGTCTGGGGTGCTCATGCTCATG
GCCCTGGACCGCTACGTGGCCATCTGCCACCCCTTACGTTATTCCACCATCCTCACCAAC
CCTGTCATCACCAAGGCAGGTCTTGCCACGTTCCTGAGGGGTGTGCTGCTCATCCTCCCA
TTCACATTCCTCACCAAGCGTCTGCCCTATTGCCGAAGCAACTTTATTCCCCATACCTAC
TGTGACCACATGTCTGTGGCCAAGGTGTCCTGTGGCAATTTCAAGGTCAATGCTATCTAT
GGTCTCTTGGCAGCCCTCCTGATTGGAGGCTTTGATATGTTCTGTATTTCTGTGTCTTAC
ACTATGATACTGAGGGCAGTAGTGAGCCTGTCATCTGCAGATGCTCGTCACAAAGCCTTC
AGCACCTGCACATCCCACATATGTGCTATTGTTATCACTTATGTTCCAGCGCTGTTCACC
ATTTTTACTCATCGTTTTGGGGGACAAAGCATTCCCCACCATGTGCATATTCTTATTGCT
AATCTCTATTTGATGTTGCCTCCTACTCTGAATCCCATTGTTTACGGAGTCAAGACCAAG
CAGATCCAGGAAGGAGTCATCAAGTTATTTTTTAAAGAGAAAGATGTCTTAGTTATGAAA


Conceptual translation

MCGENSSSLAPGFFVLNGIPGLEAAHTWIALPFCFMYIITVLGNCGLIYLISHEEALHQP
MYYFLALLSFTDVTLCTTTVPNMLCIFWFNLKEIHFNACLAQMFFVHMLTGMESGVLMLM
ALDRYVAICHPLRYSTILTNPVITKAGLATFLRGVLLILPFTFLTKRLPYCRSNFIPHTY
CDHMSVAKVSCGNFKVNAIYGLLAALLIGGFDMFCISVSYTMILRAVVSLSSADARHKAF
STCTSHICAIVITYVPALFTIFTHRFGGQSIPHHVHILIANLYLMLPPTLNPIVYGVKTK
QIQEGVIKLFFKEKDVLVMK