Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52N3 Olfactory Receptor

Gene Symbol OR52N3
Organism Dog
Family 52
Subfamily N
Pseudo No
Location chr21:28,956,600-28,957,500 (+)
Aliases cOR52N7

Sequence information


Nucleotide sequence

ATGCATGGAGCCAACAGCTCCAGCCTGACACCAAGATACTTCATCCTTAATGGGATTCCT
GAACTAGAAGCCTTACACACTTGGATCTCCCTGCCATTCTGCTTCATGTACATCATCACT
GTCCTGGGGAACTGTGGGCTCATCTACCTCATCAGCCATGAGGAGGCCCTGCATCGGCCC
ATGTATTACTTCCTAGCTTTACTGTCCCTTACAGATGTTAGTGTGTGCACTTCATTTGTT
CCTAATATGTTATGTATCTTTTGGTTCAACCTCAAAGAGATTGACTTTGATGCCTGCCTT
GTGCAGATGTTTTTCATCCACATGCTGACCGGTATGGAGTCTGGCGTGCTCATGCTTATG
GCCCTGGACCGCTATGTGGCCATTTGCTACCCTCTACGTTATTCTACCATCCTCACCAAC
ATGGTAATTACCAAAGTTGGGTTTGCCACCTTCAGTCGAAGTGTGTTGCTCATGATCCCA
TTCACTTTCCTGATTAGGCGTCTTCCCTACTGCAAGGGCAACCTCATTCACCACACCTAC
TGTGACCATATGTCTGTAGCCAAACTGTCCTGTGGCAACATCAAGATTAATGCCATCTAT
GGTCTCATAGCTGCCATACTGATAGGAGGATTTGATATGTTCTGTATCTTCATGTCTTAC
ACCATGATTATCCGTGCTGTAGTGAATCTGCCATCTTCAGATGCTCGGCACAAAGCCTTC
AGCACCTGTACATCACACATATGTGCTATTGTCATCACCTATGTCCCAGCCTTCTTCAAC
TTTTTTACTCATCGTTTTGGGGGACGCACCATACCTCACCATGTTCACATTTTTATAGCC
AATCTCTACCTGTTGTTGCCTCCCACCTTGAATCCAATTGTCTATGGAGTGAAAACCAAG
CAGATCCGTGAAGGAGTGATCAAATTGTTTTTAGAGAGAAATATTTTGAGGATGAGC


Conceptual translation

MHGANSSSLTPRYFILNGIPELEALHTWISLPFCFMYIITVLGNCGLIYLISHEEALHRP
MYYFLALLSLTDVSVCTSFVPNMLCIFWFNLKEIDFDACLVQMFFIHMLTGMESGVLMLM
ALDRYVAICYPLRYSTILTNMVITKVGFATFSRSVLLMIPFTFLIRRLPYCKGNLIHHTY
CDHMSVAKLSCGNIKINAIYGLIAAILIGGFDMFCIFMSYTMIIRAVVNLPSSDARHKAF
STCTSHICAIVITYVPAFFNFFTHRFGGRTIPHHVHIFIANLYLLLPPTLNPIVYGVKTK
QIREGVIKLFLERNILRMS