Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52N4 Olfactory Receptor

Gene Symbol OR52N4
Organism Dog
Family 52
Subfamily N
Pseudo No
Location chr21:28,865,400-28,866,300 (+)
Aliases cOR52N6

Sequence information


Nucleotide sequence

ATGATAATATTGAATAAAACAAACTGGACCCTGGTCTCATTCATTCTTAATGGAGTCCCA
GGACTGGAAGACATGCATGTGTGGATTTCCTTCCCATTCTTCTCCATGTATATTGTGGCC
ATGGTAGGGAATTGTGGGCTGTTATACCTCATCTACTATGAGGATTCATTGCACAGACCT
ATGTATTACTTTTTAGCCATGCTTTCTCTTACTGATATTGTCATGTGCTCTAGTACAATT
CCTAAAGCTCTCTGTATCTTCTGGTTTCATCTCAAGGACATTGGCTTTAATGAATGTTTG
CTCCAGATGTTCTTCATCCATACCTTCACAGGGATGGAGTCTGGAGTGCTTATGCTCATG
GCTCTGGACCGCTATGTGGCCATCTGCTACCCTCTGCGGTACTCAACTATCCTCACCAAT
CATGTCATTGCAAAGGTTGGGCTTGCTACTTTCCTGAGAGGGGTGTTGCTCATCATTCCC
TTCACTTTCCTCACGAAGCGCCTGTCCTACTGCAGAGGCAATATAATTCCCCACACCTAC
TGTGACCACATGTCTGTAGCCAAATTGTCTTGTGGCAATGTCAAGGTCAATGCCATCTAT
GGTCTGATGGTTGCCCTCCTAATTGGTGGCTTTGACATCCTGTGCATCACAATCTCCTAC
ACCATGATCCTCCGGGCAGTGGTCAGCCTCTCTTCAGCAGATGCTCGACAGAAGGCCTTC
AGCACCTGCACTGCTCACATCTGTGCCATTGTTTTCTCCTACACTCCAGCCTTCTTCTCT
TTCTTTTCCCACCGCTTTGGGGGCCACACAATCCCTCCCTCTTGCCACATCATTGTGGCC
AATATTTATCTGCTCTTGCCTCCCACTATGAACCCTATTGTTTATGGGGTGAAAACCAAG
CAGATACGAGACCGTGTCATAAGGATCCTTTCAGGGTCTAAGGACATCAAATCCCATGGC
ATA


Conceptual translation

MIILNKTNWTLVSFILNGVPGLEDMHVWISFPFFSMYIVAMVGNCGLLYLIYYEDSLHRP
MYYFLAMLSLTDIVMCSSTIPKALCIFWFHLKDIGFNECLLQMFFIHTFTGMESGVLMLM
ALDRYVAICYPLRYSTILTNHVIAKVGLATFLRGVLLIIPFTFLTKRLSYCRGNIIPHTY
CDHMSVAKLSCGNVKVNAIYGLMVALLIGGFDILCITISYTMILRAVVSLSSADARQKAF
STCTAHICAIVFSYTPAFFSFFSHRFGGHTIPPSCHIIVANIYLLLPPTMNPIVYGVKTK
QIRDRVIRILSGSKDIKSHGI