Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52N4F Olfactory Receptor

Gene Symbol OR52N4F
Organism Dog
Family 52
Subfamily N
Pseudo No
Location chr21:28,823,700-28,824,700 (+)
Aliases cOR52N8

Sequence information


Nucleotide sequence

ATGACCAAATACTTTCTTCATTTATCTCTATCTAGGAGGACCCACAAATTCTATAACATG
ATTAATGATCATTCTAGCTTGATGATGCTAATGCTGAACCAAACAGACCTGACTCCAGGT
TCATTCATTCTTAATGGGATCCCAGGACTGGAAGACATGCACATGTGGATTTCCTTCCCA
TTCTGCTCCATGTATATTGTGGCCATGGTAGGGAATTGTGGGCTTCTCTACCTCATCCAC
TATGAGGACTCCCTGCACAGGCCCATGTACTACTTTTTAGCTATGCTTTCCCTAACTGAC
CTTTTCATATGCTCTAGTACAATCCCTAAAGCCCTCAGCATACTCTGGTTCCATTTCAAG
GAAATCAGCTTTGATGGATGCCTGGTCCAGATGTTCTTTGTCCATACTTTCACAGGGATG
GAGTCTGGGGTTCTCATGCTCATGGCCCTGGACCGCTATGTGGCCATCTGCTACCCTCTG
CACTATTCTACTGCCCTCACCAATTCTGTTATTGCAAAGGCTGGGCTCTCCACCTTTCTC
AGAGGGGTGTTGCTCATCATTCCCTTCACTTTCCTCACGAAGCGCCTGCCCTACTGCAGA
GGCAATATAATTCCCCACACCTACTGTGACCACATGTCTGTAGCCAAATTATCCTGTGGG
GACATCAAGGTCAATGTCGTCTATGGTCTGACAGTTGCCCTCCTGATTGGAGGCTTTGAC
ATCCTGTGCATCACAATCTCCTACACCATGATCCTCCGGGCAGTGGTCAGCCTCTCTTCA
GCAGATGCTCGACAGAAGGCCTTCAGCACCTGCACTGCCCACATCTGTGCCATTGTTTTC
TCCTACAGCCCAGCCTTCTTCTCTTTCTTTTCCCACCGCTTTGGGGGCCACACAATCCCT
CCCTCTTGCCACATCATTGTGGCCAATATTTATTTACTCCTGCCTCCAGCTATGAATCCT
GTTGTCTATGGGGTGAAAACCAAGCAGATACGAGACTGTATTGTAAAGATCCTTTTGGGT
TCTAAGGACATCAAATCCCAAAGCATA


Conceptual translation

MTKYFLHLSLSRRTHKFYNMINDHSSLMMLMLNQTDLTPGSFILNGIPGLEDMHMWISFP
FCSMYIVAMVGNCGLLYLIHYEDSLHRPMYYFLAMLSLTDLFICSSTIPKALSILWFHFK
EISFDGCLVQMFFVHTFTGMESGVLMLMALDRYVAICYPLHYSTALTNSVIAKAGLSTFL
RGVLLIIPFTFLTKRLPYCRGNIIPHTYCDHMSVAKLSCGDIKVNVVYGLTVALLIGGFD
ILCITISYTMILRAVVSLSSADARQKAFSTCTAHICAIVFSYSPAFFSFFSHRFGGHTIP
PSCHIIVANIYLLLPPAMNPVVYGVKTKQIRDCIVKILLGSKDIKSQSI