Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52N4G Olfactory Receptor

Gene Symbol OR52N4G
Organism Dog
Family 52
Subfamily N
Pseudo No
Location chr21:28,878,000-28,879,000 (+)
Aliases cOR52N10

Sequence information


Nucleotide sequence

ATGATAATTCTGAATGAAACAGATGTAACACCAGTCTCATTCATTCTTAATGGGATCCCA
GGACTGGAAGACATGCACATGTGGATTTCCTTCCCATTCTGCTCCATGTATATTGTGGCC
ATGGTAGGGAATTGTGGGCTTCTATACCTCATCTGCTATGAGGACTCCTTGCACAGATCC
ATGTATTATTTTTTGGCCATGCTTTCCCTTACCGACCTTGTTATGTGCTCTAGTACAATC
CCTAAAGCTCTCTGCATCTTCTGGTTTCATCTCAAGAAAATTGGATTTGAAGAATGCCTA
GTCCAGATGTTCTTCATCCATACCTTCACAGGGATGGAATCTGGGGTGCTCATGCTCATG
GCCCTGGACCGCTATGTGGCCATCTGCTACCCTCTGCGCTATGCAACCATCCTCACCAAT
TCTGTCATTGCAAAGGTTGGGCTTGCTACTTTTCTGAGAGCAGTGTTGCTCATCATTCCC
TTGATTTTCTTCACCAAGAGACTACCCTATTGCAAGGGCAATATAATACACCATACCTAT
TGTGACCAGCTATCTGTAGCCAAGTTATCCTGTGGAAATATCAAGGCCAATGTTATCTAT
GGTCTGATAGCTGCCCTTCTGATTGGAGGCTTTGACATCCTGTGCATCACAATCTCCTAC
ACCATGATCCTCCGGGCAGTGGTCAGCCTCTCTTCAGCAGATGCTCGACAGAAGGCCTTC
AGCACCTGCACTGCCCACATCTGTGCCATTGTTTTCTCCTACAGTCCAGCCTTCTTCTGC
TTCTTTTTTAATCGTTTTGGGAGCCGTACAATCCCTCCTTCTTGCCACATCATTGTGGCC
AATATTTATCTGCTCCTGCCTCCCACTATGAACCCTATTGTTTATGGAGTGAAAACCAAG
CAGATACGAGACTGTATCATAAAGATCTTTTCAGGTTCTAAGAACATTAAATCCCACAGC
ACA


Conceptual translation

MIILNETDVTPVSFILNGIPGLEDMHMWISFPFCSMYIVAMVGNCGLLYLICYEDSLHRS
MYYFLAMLSLTDLVMCSSTIPKALCIFWFHLKKIGFEECLVQMFFIHTFTGMESGVLMLM
ALDRYVAICYPLRYATILTNSVIAKVGLATFLRAVLLIIPLIFFTKRLPYCKGNIIHHTY
CDQLSVAKLSCGNIKANVIYGLIAALLIGGFDILCITISYTMILRAVVSLSSADARQKAF
STCTAHICAIVFSYSPAFFCFFFNRFGSRTIPPSCHIIVANIYLLLPPTMNPIVYGVKTK
QIRDCIIKIFSGSKNIKSHST