Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52P1 Olfactory Receptor

Gene Symbol OR52P1
Organism Dog
Family 52
Subfamily P
Pseudo No
Location chr21:28,815,800-28,816,700 (+)
Aliases cOR52P1, cOR52P3

Sequence information


Nucleotide sequence

ATGCCTAGAGCTTTTGTCCAGTCTCCTAATCACACTAATCTGGACCCTTCTGTTTTTTTC
CTCCTGGGCATCCCAGGTCTGGAACAATTTCACCTGTGGCTCTCACTCCCCGTGTGCTGC
CTGGGCACAGCCACAATTGTGGGCAACATTACCATCCTGGTTGTTGTTGCCACTGAACCA
GCCCTGCACAAGCCTGTATATTTGTTCCTCTGCATGCTCTCTACCATTGACTTGGCTGCC
TCTTTCTCCACAGTTCCCAAGCTATTGGCCATCCTCTGGTGTGGAGCTGGACACATCTCT
GCCTCTGCCTGCCTGGCACAGATGTTCTTCATTCATGCCTTCTGCATGATGGAGTCTACT
GTGCTTCTGGCCATGGCCTTTGATCGCTATGTGGCCATTTGTCACCCACTCCGTTATGCT
ACTATCCTCACGGACACCATCATTGCCCGAATTGGAGTGGTAGCTATGGTGCGGGGCTCC
ATGCTCATGCTCCCATGTCCCTTCCTCATTGGGCGTTTGAGCTTCTGCCAAAGCCATGTG
ATCCCCCACACATACTGTGAGCACATGGCTGTTGTGAAGCTAGCATGTGGAGATACCAGG
CCTAACCGTGTGTATGGGCTGACAGCAGCACTATTGGTCATAGGGGTTGACTTATTCTGC
ATTGGTCTTTCCTATGTCTTTATTGCACGGGCTGTCCTCCGTCTTTCATCCCATGAAGCT
CGGTCCAAGGCCTTGGGGACCTGTGGTTCTCATGTCTGTGTCATCCTAATCTCTTATACA
CCAGCCCTCTTCTCCTTTTTTACCCATCGCTTTGGCCACCATGTTCCACTTCATATTCAC
ATTCTTTTGGCCAATGTTTATCTGCTCTTCCCACCTGCTCTTAACCCTATGGTATATGGA
GTTAAAACCAAAGAAATCCGGGAAAGGGTTATCAGGGTGTTTCAAAGGGGGCAGGGAACT
GGGTTAAAAGTACCAGAG


Conceptual translation

MPRAFVQSPNHTNLDPSVFFLLGIPGLEQFHLWLSLPVCCLGTATIVGNITILVVVATEP
ALHKPVYLFLCMLSTIDLAASFSTVPKLLAILWCGAGHISASACLAQMFFIHAFCMMEST
VLLAMAFDRYVAICHPLRYATILTDTIIARIGVVAMVRGSMLMLPCPFLIGRLSFCQSHV
IPHTYCEHMAVVKLACGDTRPNRVYGLTAALLVIGVDLFCIGLSYVFIARAVLRLSSHEA
RSKALGTCGSHVCVILISYTPALFSFFTHRFGHHVPLHIHILLANVYLLFPPALNPMVYG
VKTKEIRERVIRVFQRGQGTGLKVPE