Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52P2 Olfactory Receptor

Gene Symbol OR52P2
Organism Dog
Family 52
Subfamily P
Pseudo No
Location chr21:26,819,300-26,820,300 (-)
Aliases cOR52P4

Sequence information


Nucleotide sequence

ATGCAGTTCACAAACTACAGCCAGCAGAACCCAAACTCTTTTCTGCTCATGGGAATTCCT
GGCCTGGAGGCATCTCACTTTTGGATTGCATTTCCCTTCTGCTCCATGTATGCACTAGCA
GTGTTTGGCAACATGGCAGTGCTGCTGGTGGTGCGATCGGAGCCTGCCCTGCACCAGCCC
ATGTACCTATTCCTATGTATGCTGTCCATCATTGACCTGGTACTCTGCACTTCTACTGTG
CCCAAGCTCCTTGCACTTTTTTGGACAAATGATACTGAGATCAACTTTGGGGCCTGTGCT
ACCCAGATGTTTTTTATCCATGGCTTTTCAGCTGTTGAATCTGGTATCCTGCTAGCAATG
GCCTTTGACCGCTACTTGGCCATCTGCCAGCCACTCCACTATGGGTCATTGTTGCCTCCA
GAGGCTGTGGGCAAGCTGGCAGCTGCTGCTGTGTTTCGTGGCTTGGGGCTCATGACCCCA
CTCACCTGCTTACTGGCAAGACTGAGCTACTGTAGCCGAGTGGTGGCCCATTCCTACTGT
GAGCATATGGCTGTGGTAAAGCTGGCATGTGGGGGCACACGGCCAAACAACATCTATGGC
ATCACTGCTGCCACACTAGTTGTGGGCACAGACTCAATTTGCATCGCTGTCTCCTATGCG
CTCATCCTCCGGGCTGTGTTAGGCCTCTCCTCCAAAGAAGCAAGGGCTAAGACATTTGGT
ACTTGTGGCTCCCACCTGGGTGTCATTCTTCTCTTCTATACACCAGGACTCTTCTCATTC
TACACACAACGCTTTGGCCAGCATGTTCCCCGGCACATCCACATCCTCCTGGCTGACCTC
TACCTTGTTGTACCACCCATGCTCAACCCTATCATCTATGGCATGAAGACCAAACAGATC
CGGGTTGGAGCCCTCCGACTGCTGAAGCGGGGCATTGTTCAGTCT


Conceptual translation

MQFTNYSQQNPNSFLLMGIPGLEASHFWIAFPFCSMYALAVFGNMAVLLVVRSEPALHQP
MYLFLCMLSIIDLVLCTSTVPKLLALFWTNDTEINFGACATQMFFIHGFSAVESGILLAM
AFDRYLAICQPLHYGSLLPPEAVGKLAAAAVFRGLGLMTPLTCLLARLSYCSRVVAHSYC
EHMAVVKLACGGTRPNNIYGITAATLVVGTDSICIAVSYALILRAVLGLSSKEARAKTFG
TCGSHLGVILLFYTPGLFSFYTQRFGQHVPRHIHILLADLYLVVPPMLNPIIYGMKTKQI
RVGALRLLKRGIVQS