Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52U1 Olfactory Receptor

Gene Symbol OR52U1
Organism Dog
Family 52
Subfamily U
Pseudo No
Location chr21:28,754,400-28,755,400 (+)
Aliases cOR52U4

Sequence information


Nucleotide sequence

ATGACTGTGTGCAATGTCTCCCTGGGGCATCCTCCTTTCTTCATTCTCCAAGGCATTCCC
GGGATGGAGGACAAACACAGATGGATCTCTATCCCCTTCTGTTCCATGTACTTCATCACC
ATCCTTGGGAACTGCACCATCATCTTCATCATCTGCACAGAGCGCTCCCTGCACAAGCCC
ATGTTCCTGCTCCTCTGCATGTTGGCCCTCACAGACCTGGGCATGTCCACTACCACCATT
CCCAAAGTGCTATGCATCTTCTGGTTTAGACACAGTGAGATCAGCTATGTGGGCTGTCTG
GTCCAAATGTTCTTCATTCACTCCATATCGGCCATGCAGTCTGCCATTCTGATGACCATG
GCCTTTGACCGCTACGTAGCCATCTGTGAGCCCCTGCGCTATGCCACCATCCTTTCCAAT
AGTCGCATTGGGCTCATTGGCTTAGTGAGTTTAGTAAGAGCCATCCTTTTCATTCTGCCC
ATGCCTGTCCTCCTCCAGAAGATGCCTTTTCATGCGAATCATGTCATCCCCACCACCTAC
TGTGAACACATGGCTGTGGTGAAGATGGTGTGTGTGGACACCACAGTCAACCGGATATAT
GGTCTGGTGGTGGCCTTGTTGGTTGCCGGGCTAGACATCTCAGCTATCGCCTCCTCTTAT
GTGCTTATCATCAAGGCTGTCTTGCGACTGTCTTCTAAGGAAGCCCACCACAAAGCAGTC
AACACTTGCACCACTCATATCTGTGTCATGCTTATCTCTTACACGCCCTCACTGTTCTCT
TTCCTCACTCACCGCTTTGGCAGGGGAATTCCACTGCATGTGCACACCATTCTTGGAAAC
CTCTACTTCCTTGTACCTCCAATGCTCAATCCTATTATTTATGCAGTGAAAACCAAGGAG
TTTCGGGAAAAACTGATCAAATATGGGTACTGGAAGAAGGAGCTCAAAACCGTTACCCAT
GGTCCGAAGCCTGTC


Conceptual translation

MTVCNVSLGHPPFFILQGIPGMEDKHRWISIPFCSMYFITILGNCTIIFIICTERSLHKP
MFLLLCMLALTDLGMSTTTIPKVLCIFWFRHSEISYVGCLVQMFFIHSISAMQSAILMTM
AFDRYVAICEPLRYATILSNSRIGLIGLVSLVRAILFILPMPVLLQKMPFHANHVIPTTY
CEHMAVVKMVCVDTTVNRIYGLVVALLVAGLDISAIASSYVLIIKAVLRLSSKEAHHKAV
NTCTTHICVMLISYTPSLFSFLTHRFGRGIPLHVHTILGNLYFLVPPMLNPIIYAVKTKE
FREKLIKYGYWKKELKTVTHGPKPV