Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52U1B Olfactory Receptor

Gene Symbol OR52U1B
Organism Dog
Family 52
Subfamily U
Pseudo No
Location chr21:28,772,800-28,773,800 (+)
Aliases cOR52U3

Sequence information


Nucleotide sequence

ATGACTGTGTGCAATGTCTCCCTGGGGCATCCTCCTTTCTTCATTCTCCAAGGCATTCCC
GGGATGGAGGACAAACACAGATGGATCTCTATCCCCTTCTGTTCCATGTACTTCATCACC
ATCCTTGGGAACTGCACCATCATCTTCATCATCTGCACAGAGCGCTCCCTGCACAAGCCC
ATGTTCCTGCTCCTCTGCATGTTGGCCCTCACAGACCTGGGCATGTCCACTACCACCATT
CCCAAAGTGCTATGCATCTTCTGGTTTAGACACAGTGAGATCAGCTATGTGGGCTGTCTG
GTCCAAATGTTCTTCATTCACTCCATATCTGTCATGCAGTCTGCCATTCTGATGACCATG
GCCTTTGACCGCTACGTAGCCATCTGTGAGCCCCTGCGCTATGCCACCATCCTTTCCAAT
AGTCGCATTGGGCTCATTGGCTTAGTGGGTTTAGTAAGAGCCATCCTTTTCATTCTGCCC
ATGCCTGTCCTCCTCCAGAAGATGCCTTTTCATGCGAATCATGTCATCCCCACCACCTAC
TGTGAACACATGGCTGTGGTGAAGATGGTGTGTGTGGACACCACAGTCAACCGGATATAT
GGTCTGGTGGTGGCCTTGTTGGTTGCCGGGCTAGACATCTCAGCTATTGCCTCCTCTTAT
GTGCTTATCATCCAGGCTGTCCTGCGGCTGTCTTCTAAGGAAGCCCACCACAAAGCAGTC
AACACCTGCACTGCACACATTGTTGTCATGCTTCTCTACTATACTCCCTCACTGTTCTCT
TTCCTCACTCACCGCTTTGGCAGGGGAATTCCACTGCATGTGCACACCATTCTTGGAAAC
CTCTACTTCCTTATACCTCCAATGCTCAATCCTATTATTTATGCAGTGAAAACCAAGGAG
TTTCGGGAAAAACTGACCAAATATGGGTACTGGATGAAAAAGCACATAATCAGTAACCAT
GGTCAGAATCCTTTC


Conceptual translation

MTVCNVSLGHPPFFILQGIPGMEDKHRWISIPFCSMYFITILGNCTIIFIICTERSLHKP
MFLLLCMLALTDLGMSTTTIPKVLCIFWFRHSEISYVGCLVQMFFIHSISVMQSAILMTM
AFDRYVAICEPLRYATILSNSRIGLIGLVGLVRAILFILPMPVLLQKMPFHANHVIPTTY
CEHMAVVKMVCVDTTVNRIYGLVVALLVAGLDISAIASSYVLIIQAVLRLSSKEAHHKAV
NTCTAHIVVMLLYYTPSLFSFLTHRFGRGIPLHVHTILGNLYFLIPPMLNPIIYAVKTKE
FREKLTKYGYWMKKHIISNHGQNPF