Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52W1 Olfactory Receptor

Gene Symbol OR52W1
Organism Dog
Family 52
Subfamily W
Pseudo No
Location chr21:29,536,200-29,537,100 (+)
Aliases cOR52W2

Sequence information


Nucleotide sequence

ATGGCAGAAGGTCCACATCCCAACTCCACCTTCCCACGCCCCACTTTCTTCATACTGACT
GGCATTCCAGGGTTAGGGGGTACCCAGACCTGGCTGACACTGGTCTTTGGGCCCATGTAT
CTGCTGGCCCTGCTGGGAAATGGAACACTGTTGGCATTGGTGCAGATAGACTCCACACTG
CAGCAGCCCATGTTTCTACTCCTGGCCACACTGGCAGCCACAGACCTGGGCTTAGCCACA
TCTATAGCCCCAGGGTTGCTTGCTGTGATGTGGCTTGGGCCCCGGCCTGTGCCATATGGT
GTCTGCCTGGCCCAGATGTTCTTTGTTCATGCACTGACTGCTGTGGAATCCGGTGTACTG
TTGGCCATGGCCTGTGATCGTGCTGTGGCAGTAGGGCGTCCCCTACATTACCCTCTCCTA
ATCACCAAAGCCCGTGTAGGCTATGCAGCACTGGCACTGGCCCTGAAAGCTGTGGCTATT
GTTGTGCCTTTCCCTCTGCTGGTGGCGCGATTTGAGTACTTCCGAGCCAAGACCATAGAC
CATGCCTACTGTGCACACATGGCAGTGGTAGAGCTGGTGGTGGGCAACACACAAGCTAAC
AATTTGTATGGGCTGGCACTTTCACTGGCTGTGTCAGGCATAGATATCCTGGGCATCGCT
GGCTCTTATGGACTCATTGCCCACACTGTACTGCGGCTGCCTACCTGGGAGGCCCGGGCC
AAGGCCTTTGGCACATGTAGTTCCCACATCTGTGTCATTCTGGCCTTCTATGTACCTGGT
CTCTTCTCATACCTCACACATCGCTTTGGTCGTCACACCATCCCAAAGCCTGTGCACATT
CTTCTCTCTAACATCTATTTGCTGCTGCCACCTGCCCTCAACCCACTCATCTATGGAGTC
CGCACCAAGCAAATCAGGGACCGGCTCCTGGAAACCTTCACATTCAGAAAAAGCCAGCTC


Conceptual translation

MAEGPHPNSTFPRPTFFILTGIPGLGGTQTWLTLVFGPMYLLALLGNGTLLALVQIDSTL
QQPMFLLLATLAATDLGLATSIAPGLLAVMWLGPRPVPYGVCLAQMFFVHALTAVESGVL
LAMACDRAVAVGRPLHYPLLITKARVGYAALALALKAVAIVVPFPLLVARFEYFRAKTID
HAYCAHMAVVELVVGNTQANNLYGLALSLAVSGIDILGIAGSYGLIAHTVLRLPTWEARA
KAFGTCSSHICVILAFYVPGLFSYLTHRFGRHTIPKPVHILLSNIYLLLPPALNPLIYGV
RTKQIRDRLLETFTFRKSQL