Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR52Z1 Olfactory Receptor

Gene Symbol OR52Z1
Organism Dog
Family 52
Subfamily Z
Pseudo No
Location chr21:28,122,800-28,123,800 (-)
Aliases cOR52Z2, cOR52Z3

Sequence information


Nucleotide sequence

ATGCTGCAGGAGATGGCCCCTTTCTCTTACAACCACACCAATACCCAGGATATGTGGTAT
GTCCTGATTGGAATCCCAGGGCTGGAAGATTCTCACCCCTGGATCTCCATCCCTATCTGT
TCGATGTACGTGTTGGCTGTCATAGGCAACAGCTTCTTGATCTTCCTGATTGTGACTGAG
CGCAGTCTCCACGAGCCCATGTATTTTTTCCTTTCCATGCTGGCCTCGGCAGATGTGCTG
CTCTCCACAGCCACGGCCCCCAAGATGCTGGCCATCTTCTGGTTCCAGTCCATGGATATA
TCCTTCGGTAGCTGTGTATCTCAGATGTTCTTCATACATTTCATCTTTGTGGCAGAATCT
GCTATTCTCCTGGCCATGGCATTTGACCGCTATGTGGCCATCTGTCACCCCCTGAGATAC
ACCACCATCTTAACCTCCTCAGCCACTGGGAAGATTGGCATAGCAGCTGTGGTCAGGAGC
TTTTTCATCTGCCTTCCATTCATCTTCCTGGTTTACCGACTTAGGTACTGTGGGAGAAAC
ATCATTCCCCACTCCTACTGTGAGCACATGGGCATTGCCAGATTGGCATGTGACAGTATC
AAGGTCAACATCATCTATGGCCTGACTGTGGCCCTACTGTCTACAGGACTGGATATTGTG
TTCATCATTATGTCGTACACCATGATCCTTTGCACAGTGTTTCAGATACCTTCCTGGGCT
GCCAGATTCAAGGCCCTCAACACATGTGCTTCCCATATCTGTGTCATCCTTATGTTCTAT
GCCCCAGCATTCTTTTCATTTTTTGCCCATCGTTTTGGGGGTAAAACCATCCCTCACCAC
ATCCACATCCTGGTAGCCAATCTCTATGTGGTTGTTCCCCCTATGCTAAACCCCATCATT
TATGGGGTGAAGACCAAACAGATTCAAGACCGAGTAACATTGCTTTTCTCCTTCATCAGC
ACATGTTGT


Conceptual translation

MLQEMAPFSYNHTNTQDMWYVLIGIPGLEDSHPWISIPICSMYVLAVIGNSFLIFLIVTE
RSLHEPMYFFLSMLASADVLLSTATAPKMLAIFWFQSMDISFGSCVSQMFFIHFIFVAES
AILLAMAFDRYVAICHPLRYTTILTSSATGKIGIAAVVRSFFICLPFIFLVYRLRYCGRN
IIPHSYCEHMGIARLACDSIKVNIIYGLTVALLSTGLDIVFIIMSYTMILCTVFQIPSWA
ARFKALNTCASHICVILMFYAPAFFSFFAHRFGGKTIPHHIHILVANLYVVVPPMLNPII
YGVKTKQIQDRVTLLFSFISTCC