Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR55B1 Olfactory Receptor

Gene Symbol OR55B1
Organism Dog
Family 55
Subfamily B
Pseudo No
Location chr21:26,635,500-26,636,500 (-)
Aliases cOR55B3P

Sequence information


Nucleotide sequence

ATGGGTGAAGATGGAAATACCAGCACCTTCAACATCTCCTACACCAACTTCTTCCTGGTG
GGCTTCCCTGGATTCCGAGAGTGGCGACCTCTCCTGGTCCTGCCCCTTACCTTCCTATAT
GTGACCGTCATCTCAGCCAATGCCCTGGTCATCCACACAGTGGTGGCCCAGCGGAGCCTG
CATCAGCCCATGTACATGCTCATCGCCCTGCTCCTGGCTGTCAACATTTGTGCTGCCACT
GCCGTGATGCCCAAAATGCTGGAGGGCTTTGTGCATTATGCTAACCCCATATCACTGCAC
AGCTGCCTAGCCCAGATGTTCTTTATCTACTTCACTCTTCTTCTGGACTACAATCTCCTG
CTGGCCATGGCCCTAGACCGCTATGTCGCCATCTGTCACCCACTCCGCTATACTGACCTA
ATGACCTCTCACCTGCTTGGTGTGCTGGCCATTCTTGCCCTGACACAGAGCCTGGGAGTG
GCAGTGCCTTTGGTAGTGCTAACATCACAAGCTCGATTCTGCCGGACAATGGTGATTCCA
CACTTCACCTGTGAGTACATTGCACTGCTGAGCATAGCTTGTGGAGACTTGACTTTCAAC
AATAGGTTGGGACTGGCCATGCGGTTGGTCACTGTGACCTTTGATCTCGCCCTGCTAGGG
ACCTCCTACACCCGCATCATTTATGCTGCCTTTCGGATCTCTTCTGGGGGAGCCCGAGCT
AAGGCCTTGCACACATGTGGCTCCCACTTACTAGTCATCCTCACTATCTACCTCTCTGGT
CTCTCCACTTCCATTGTTTTCCGGGTAGCCAAGACTGTGTCTCAGGATGTCCAGAACCTG
CTCAGTGCCATCTACTTGCTGCTCCCAGGCACCTTGAATCCTGTCATTTATGGGGTGAGG
ACCAGGGAGATCCGGCAACATGTGGAAAAGATGCTCTTTAGCAAGATATCAGCCCAGGAA
GTTGGGGAGAAGCCA


Conceptual translation

MGEDGNTSTFNISYTNFFLVGFPGFREWRPLLVLPLTFLYVTVISANALVIHTVVAQRSL
HQPMYMLIALLLAVNICAATAVMPKMLEGFVHYANPISLHSCLAQMFFIYFTLLLDYNLL
LAMALDRYVAICHPLRYTDLMTSHLLGVLAILALTQSLGVAVPLVVLTSQARFCRTMVIP
HFTCEYIALLSIACGDLTFNNRLGLAMRLVTVTFDLALLGTSYTRIIYAAFRISSGGARA
KALHTCGSHLLVILTIYLSGLSTSIVFRVAKTVSQDVQNLLSAIYLLLPGTLNPVIYGVR
TREIRQHVEKMLFSKISAQEVGEKP