Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR55B4P Olfactory Receptor

Gene Symbol OR55B4P
Organism Dog
Family 55
Subfamily B
Pseudo Yes
Location chr21:26,646,200-26,647,100 (-)
Aliases cOR55B4P

Sequence information


Nucleotide sequence

ATGTCAGCGTGGAGCAATGGCAGCTCCAATGTGTCCTATAGCAGCTTTCTGCTGGTGGGC
TTCCCAGGGCTGCAGGAGTCCCGCGCCCTCCTGGTGCTGCCCTTCCTCAGCCTCTATCTG
GTGATCGTCTCTGCCAATGCGCTGGTCATCCACACAGTGGTGGCCCAGCGGAGCCTGCAT
CAGCCCATGTACCTGCTCATTGCCCTGCTCCTCGCTGTGAACATCTGTGTTGCCACCACT
GTGCTTCCCACCATGATGTTCAGCTTCTCCACCTACTTCAACCACATCTCCCTGCCTCGC
TGTCTGTTCCAGATGTTCTGCATCTACTTCCTCATTGTCTTTGACTGCAATCCTCCTGGT
CATGGCCCTAGACCGCTATGTTGCCATCTGCTACCCTCTCCGCTATCCCAAGCTAGTGAC
AGCCCAGCTGCTGGCTGGCCTGCTGGGCGCGGCAGCTGCCAGGAGCACTTGCATCGTTGC
TCCCGTGGTGGGGTTGGCCTCCCAGGTTCGCTTCTGCCGTTCACACATAATCCACCACTT
TGCCTGTGAGCACATGGCCCTCATGAAGCTCTCCTGTGGGGACATCTCCCTGAACAAGAC
TGTGGGGCTCACTGTCCGCATCTTCAACAGAGTCCTGGACATGCTACTACTTGGAGCTTC
CTACTCCCGCATCATCCATGCCGCCTTCCGGATTTCATCAGGTAGAGCACGTTCCAAGGC
CCTGAACACCTGTGGCTCCCACCTGCTGGTCATCTTCACCATCTACTCTTCCACCATGTC
CTCATCCGTCGTCTACCGTGTGGCTCGCGCCGCCTCATAGGACGTGCACAACCTGCTCAG
TGCCTTCTACCTGCTGCTCCCGTGTCTGGTGAACCCCTTCATCTATGGAGCCAGGACCAA
GGAAATCCGGCAACACCTGGCCACTCTGTTCCAAAGGGCACAGCTACCAGCGCCCCCT


Conceptual translation

MSAWSNGSSNVSYSSFLLVGFPGLQESRALLVLPFLSLYLVIVSANALVIHTVVAQRSLH
QPMYLLIALLLAVNICVATTVLPTMMFSFSTYFNHISLPRCLFQMFCIY//SLSLTAI
LLVMALDRYVAICYPLRYPKLVTAQLLAGLLGAAAARSTCIVAPVVGLASQVRFCRSHII
HHFACEHMALMKLSCGDISLNKTVGLTVRIFNRVLDMLLLGASYSRIIHAAFRISSGRAR
SKALNTCGSHLLVIFTIYSSTMSSSVVYRVARAAS*DVHNLLSAFYLLLPCLVNPFIYGA
RTKEIRQHLATLFQRAQLPAPP