Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR56A1 Olfactory Receptor

Gene Symbol OR56A1
Organism Dog
Family 56
Subfamily A
Pseudo No
Location chr21:29,337,900-29,338,800 (-)
Aliases cOR56A23, cOR56A25

Sequence information


Nucleotide sequence

ATGGCTTCACCCAGCAACTACTCCACTGCTCCAGTCTCCGAATTCCTCCTCATCTGCTTT
CCTAACTACCAGAGTTGGCAGCACTGGCTGTCCCTGCCCCTCAGCCTCCTCTTCCTCCTG
GCCATGGGGGCCAACGCCACCCTCTTGATCACTATCCGGCTGGAGGCCTCTCTGCATGAG
CCCATGTACTACCTGCTCAGCCTCCTCTCCCTGCTGGACATCGTGCTCTGCCTCACTGTC
ATCCCCAAGGTCCTGGCCATCTTCTGGTTTGATCTGAGGTCCATCAGCTTCTCTGCCTGC
TTCCTCCAGATGTTCATCATGAACAGTTTCCTCCCCATGGAGTCTTGCACATTCATGGTC
ATGGCCTATGACCGCTATGTGGCCATCTGCCACCCACTGAGGTATCCATCCATCATCACT
AACCAATTTGTGGCCAAAGCTAGTGCTTTCATTGTCACCCGGAATGCCCTTCTCACTGCA
CCTATTCCTATTCTCACCGCCCAGCTCCATTATTGTGGGAAAAATGTCATTGAGAACTGC
ATCTGTGCCAACTTGTCTGTGTCCAGGCTATCCTGTGACAATTTCACCCTTAACAGAATC
TACCAATTTGTGGCTGGTTGGACTTTACTGGGCTCAGATTTCATCCTCATCTTCCTCTCC
TACACCTTTATCCTAAGAGCTGTGCTTAGGTTCAAGGCTGAGGGGGCTGCTGTCAAAGCT
CTGAGCACATGTGGCTCTCACTTCATCCTCATCCTGTTCTTCAGCACCATCCTGCTGGTT
GTTGTGTTAACAAATGTGGCCAGAAAGAGTGTCCCTATGGACATCCTCATCTTGCTCAAT
GTCCTTCATCACCTCATACCTCCTGCCTTGAACCCTATTGTATATGGAGTTCGGACCAAA
GAGATAAAACAAGGAATGAATAAATTGCTGTGGAAAAGGATG


Conceptual translation

MASPSNYSTAPVSEFLLICFPNYQSWQHWLSLPLSLLFLLAMGANATLLITIRLEASLHE
PMYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLRSISFSACFLQMFIMNSFLPMESCTFMV
MAYDRYVAICHPLRYPSIITNQFVAKASAFIVTRNALLTAPIPILTAQLHYCGKNVIENC
ICANLSVSRLSCDNFTLNRIYQFVAGWTLLGSDFILIFLSYTFILRAVLRFKAEGAAVKA
LSTCGSHFILILFFSTILLVVVLTNVARKSVPMDILILLNVLHHLIPPALNPIVYGVRTK
EIKQGMNKLLWKRM